BLASTX nr result
ID: Akebia27_contig00027289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027289 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007294415.1| hypothetical protein MBM_06526 [Marssonina b... 75 1e-11 ref|XP_001549940.1| predicted protein [Botryotinia fuckeliana B0... 62 1e-07 gb|ELQ34406.1| hypothetical protein OOU_Y34scaffold00767g10 [Mag... 60 3e-07 emb|CCU82469.1| hypothetical protein BGHDH14_bgh04524 [Blumeria ... 56 5e-06 >ref|XP_007294415.1| hypothetical protein MBM_06526 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862259|gb|EKD15310.1| hypothetical protein MBM_06526 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 118 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 84 IKMGFFYSKHVGGRRGGATFSADRHGMRRPIMNFRLCGFNCFR 212 + MGFFYSK +GGRR GAT +ADRHG+RRPI FR CG NCFR Sbjct: 76 LTMGFFYSKGIGGRRAGATITADRHGLRRPIFRFRCCGLNCFR 118 >ref|XP_001549940.1| predicted protein [Botryotinia fuckeliana B05.10] Length = 41 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 90 MGFFYSKHVGGRRGGATFSADRHGMRRPIMNFRLCGFNCFR 212 M F+SK VGGRR GA +ADRHG+R+P+ RLCG NCFR Sbjct: 1 MPLFWSKGVGGRRFGANITADRHGVRKPVWRMRLCGLNCFR 41 >gb|ELQ34406.1| hypothetical protein OOU_Y34scaffold00767g10 [Magnaporthe oryzae Y34] gi|440481122|gb|ELQ61738.1| hypothetical protein OOW_P131scaffold01155g10 [Magnaporthe oryzae P131] Length = 44 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = +3 Query: 90 MGFFYSKHVGGRRGGATFSADRHGMRRPIMNFRLCGFNCFR 212 M FFYSK VGGRR G + ADRHG+RR F +CGFNCF+ Sbjct: 1 MPFFYSKGVGGRRFGTSIHADRHGVRRGPWRFNICGFNCFK 41 >emb|CCU82469.1| hypothetical protein BGHDH14_bgh04524 [Blumeria graminis f. sp. hordei DH14] Length = 41 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +3 Query: 90 MGFFYSKHVGGRRGGATFSADRHGMRRPIMNFRLCGFNCFR 212 M F+SKH GGRR GA DRHG+ +P+ FR G NCFR Sbjct: 1 MPLFFSKHFGGRRAGAHVHVDRHGIHKPVFRFRCFGLNCFR 41