BLASTX nr result
ID: Akebia27_contig00027191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027191 (1460 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007149288.1| hypothetical protein PHAVU_005G057900g [Phas... 59 7e-06 ref|XP_006370190.1| glycosyl transferase family 1 family protein... 58 9e-06 >ref|XP_007149288.1| hypothetical protein PHAVU_005G057900g [Phaseolus vulgaris] gi|561022552|gb|ESW21282.1| hypothetical protein PHAVU_005G057900g [Phaseolus vulgaris] Length = 480 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 LKLLRNGALETGSSARWANEWEEHAKPLISE 95 LK+L+ GALETGSSARWA EWEEHAKPLI+E Sbjct: 445 LKVLKYGALETGSSARWATEWEEHAKPLITE 475 >ref|XP_006370190.1| glycosyl transferase family 1 family protein [Populus trichocarpa] gi|550349369|gb|ERP66759.1| glycosyl transferase family 1 family protein [Populus trichocarpa] Length = 481 Score = 58.2 bits (139), Expect = 9e-06 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 LKLLRNGALETGSSARWANEWEEHAKPLISEA 98 LKLLRNGALE GSS RWA EWEEHAKPLISEA Sbjct: 438 LKLLRNGALEMGSS-RWATEWEEHAKPLISEA 468