BLASTX nr result
ID: Akebia27_contig00027034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027034 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520889.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_006435947.1| hypothetical protein CICLE_v10033031mg [Citr... 56 6e-06 >ref|XP_002520889.1| conserved hypothetical protein [Ricinus communis] gi|223540020|gb|EEF41598.1| conserved hypothetical protein [Ricinus communis] Length = 150 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 319 IGDDEGREPIDYNRRAHIFDTCSRVFQGLKERDA 420 +GDDEGR+P DYNRRA IFD SRVFQ LKER A Sbjct: 112 MGDDEGRDPTDYNRRAQIFDKSSRVFQALKERTA 145 >ref|XP_006435947.1| hypothetical protein CICLE_v10033031mg [Citrus clementina] gi|568865572|ref|XP_006486148.1| PREDICTED: uncharacterized protein LOC102606798 [Citrus sinensis] gi|557538143|gb|ESR49187.1| hypothetical protein CICLE_v10033031mg [Citrus clementina] Length = 139 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 319 IGDDEGREPIDYNRRAHIFDTCSRVFQGLKER 414 +GDDEG+EP DYNRRA IFD SRVFQ LKER Sbjct: 101 MGDDEGKEPTDYNRRAQIFDKSSRVFQALKER 132