BLASTX nr result
ID: Akebia27_contig00027030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027030 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXL95298.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygena... 150 2e-34 gb|EXL95296.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygena... 150 2e-34 ref|XP_007599041.1| 14-3-3 family protein [Colletotrichum fiorin... 150 2e-34 gb|EWY98435.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygena... 150 2e-34 sp|Q99002.1|1433_TRIHA RecName: Full=14-3-3 protein homolog; Alt... 150 2e-34 ref|XP_001220667.1| DNA damage checkpoint protein rad24 [Chaetom... 150 2e-34 ref|XP_387023.1| 1433_TRIHA 14-3-3 PROTEIN HOMOLOG (TH1433) [Fus... 150 2e-34 gb|ETS87729.1| 14-3-3 protein [Pestalotiopsis fici W106-1] 150 2e-34 gb|ERS98400.1| hypothetical protein HMPREF1624_05184 [Sporothrix... 150 2e-34 gb|EPE03945.1| 14-3-3 protein [Ophiostoma piceae UAMH 11346] 150 2e-34 gb|EOO02485.1| putative dna damage checkpoint protein rad24 prot... 150 2e-34 gb|ENH87503.1| DNA damage checkpoint protein rad24 [Colletotrich... 150 2e-34 gb|ENH64510.1| 14-3-3 protein like protein [Fusarium oxysporum f... 150 2e-34 gb|EMT63821.1| 14-3-3 protein like protein [Fusarium oxysporum f... 150 2e-34 gb|EMR71702.1| putative dna damage checkpoint protein rad24 prot... 150 2e-34 ref|XP_007287224.1| DNA damage checkpoint protein rad24 [Colleto... 150 2e-34 gb|ABD49711.1| TH14-3-3 [Metarhizium anisopliae] gi|594721395|gb... 150 2e-34 emb|CCE27930.1| probable 14-3-3-like protein [Claviceps purpurea... 150 2e-34 gb|EJT81611.1| 14-3-3 family protein [Gaeumannomyces graminis va... 150 2e-34 emb|CCF35517.1| 14-3-3 family protein [Colletotrichum higginsianum] 150 2e-34 >gb|EXL95298.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591463818|gb|EXL95299.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 247 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 139 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 198 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 199 MQLLRDNLTLWTS 211 >gb|EXL95296.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591463816|gb|EXL95297.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 268 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >ref|XP_007599041.1| 14-3-3 family protein [Colletotrichum fioriniae PJ7] gi|588895659|gb|EXF77304.1| 14-3-3 family protein [Colletotrichum fioriniae PJ7] Length = 270 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|EWY98435.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum FOSC 3-a] gi|587676108|gb|EWY98436.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum FOSC 3-a] gi|587697905|gb|EWZ44510.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum Fo47] gi|587697906|gb|EWZ44511.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum Fo47] gi|587727276|gb|EWZ98613.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. lycopersici MN25] gi|587727277|gb|EWZ98614.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752078|gb|EXA49794.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. pisi HDV247] gi|587752079|gb|EXA49795.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. pisi HDV247] gi|590040016|gb|EXK41874.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. melonis 26406] gi|590040017|gb|EXK41875.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. melonis 26406] gi|590073250|gb|EXL00775.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. raphani 54005] gi|590073251|gb|EXL00776.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. raphani 54005] gi|591426701|gb|EXL61838.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591426702|gb|EXL61839.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591441082|gb|EXL73730.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591441083|gb|EXL73731.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591507504|gb|EXM36767.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591507505|gb|EXM36768.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 247 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 139 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 198 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 199 MQLLRDNLTLWTS 211 >sp|Q99002.1|1433_TRIHA RecName: Full=14-3-3 protein homolog; AltName: Full=Th1433 gi|806859|gb|AAB17101.1| 14.3.3. protein [Trichoderma harzianum] Length = 262 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >ref|XP_001220667.1| DNA damage checkpoint protein rad24 [Chaetomium globosum CBS 148.51] gi|88185743|gb|EAQ93211.1| DNA damage checkpoint protein rad24 [Chaetomium globosum CBS 148.51] Length = 264 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >ref|XP_387023.1| 1433_TRIHA 14-3-3 PROTEIN HOMOLOG (TH1433) [Fusarium graminearum PH-1] gi|408388322|gb|EKJ68008.1| hypothetical protein FPSE_11819 [Fusarium pseudograminearum CS3096] gi|558862910|gb|ESU12993.1| hypothetical protein FGSG_06847 [Fusarium graminearum PH-1] gi|596542320|gb|EYB22787.1| hypothetical protein FG05_06847 [Fusarium graminearum] Length = 272 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|ETS87729.1| 14-3-3 protein [Pestalotiopsis fici W106-1] Length = 264 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|ERS98400.1| hypothetical protein HMPREF1624_05184 [Sporothrix schenckii ATCC 58251] Length = 267 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|EPE03945.1| 14-3-3 protein [Ophiostoma piceae UAMH 11346] Length = 266 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|EOO02485.1| putative dna damage checkpoint protein rad24 protein [Togninia minima UCRPA7] Length = 264 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|ENH87503.1| DNA damage checkpoint protein rad24 [Colletotrichum orbiculare MAFF 240422] Length = 268 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|ENH64510.1| 14-3-3 protein like protein [Fusarium oxysporum f. sp. cubense race 1] gi|517313859|emb|CCT66032.1| probable 14-3-3-like protein [Fusarium fujikuroi IMI 58289] gi|584134483|gb|EWG43846.1| 14-3-3 family protein [Fusarium verticillioides 7600] gi|584134484|gb|EWG43847.1| 14-3-3 family protein [Fusarium verticillioides 7600] gi|587676105|gb|EWY98433.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum FOSC 3-a] gi|587676106|gb|EWY98434.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum FOSC 3-a] gi|587697903|gb|EWZ44508.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum Fo47] gi|587697904|gb|EWZ44509.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum Fo47] gi|587727274|gb|EWZ98611.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. lycopersici MN25] gi|587727275|gb|EWZ98612.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752076|gb|EXA49792.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. pisi HDV247] gi|587752077|gb|EXA49793.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. pisi HDV247] gi|590040014|gb|EXK41872.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. melonis 26406] gi|590040015|gb|EXK41873.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. melonis 26406] gi|590073248|gb|EXL00773.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. raphani 54005] gi|590073249|gb|EXL00774.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. raphani 54005] gi|591426699|gb|EXL61836.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591426700|gb|EXL61837.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591441080|gb|EXL73728.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591441081|gb|EXL73729.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591507502|gb|EXM36765.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591507503|gb|EXM36766.1| tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 268 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|EMT63821.1| 14-3-3 protein like protein [Fusarium oxysporum f. sp. cubense race 4] Length = 410 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 302 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 361 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 362 MQLLRDNLTLWTS 374 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/66 (71%), Positives = 54/66 (81%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIA +E K ++ Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAVTSIEQKEESKGNSSQ 219 Query: 182 MQLLRD 199 + L+++ Sbjct: 220 VTLIKE 225 >gb|EMR71702.1| putative dna damage checkpoint protein rad24 protein [Eutypa lata UCREL1] Length = 264 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >ref|XP_007287224.1| DNA damage checkpoint protein rad24 [Colletotrichum gloeosporioides Nara gc5] gi|429848156|gb|ELA23670.1| DNA damage checkpoint protein rad24 [Colletotrichum gloeosporioides Nara gc5] gi|530475616|gb|EQB55651.1| hypothetical protein CGLO_04397 [Colletotrichum gloeosporioides Cg-14] Length = 268 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|ABD49711.1| TH14-3-3 [Metarhizium anisopliae] gi|594721395|gb|EXV04282.1| hypothetical protein X797_001954 [Metarhizium robertsii] Length = 269 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >emb|CCE27930.1| probable 14-3-3-like protein [Claviceps purpurea 20.1] Length = 270 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >gb|EJT81611.1| 14-3-3 family protein [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 268 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232 >emb|CCF35517.1| 14-3-3 family protein [Colletotrichum higginsianum] Length = 270 Score = 150 bits (378), Expect = 2e-34 Identities = 73/73 (100%), Positives = 73/73 (100%) Frame = +2 Query: 2 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 181 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI Sbjct: 160 TELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTLI 219 Query: 182 MQLLRDNLTLWTS 220 MQLLRDNLTLWTS Sbjct: 220 MQLLRDNLTLWTS 232