BLASTX nr result
ID: Akebia27_contig00027026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00027026 (548 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003663856.1| hypothetical protein MYCTH_2127657 [Myceliop... 62 1e-07 ref|XP_003304894.1| hypothetical protein PTT_17622 [Pyrenophora ... 59 8e-07 ref|XP_003664830.1| hypothetical protein MYCTH_2040301, partial ... 56 5e-06 >ref|XP_003663856.1| hypothetical protein MYCTH_2127657 [Myceliophthora thermophila ATCC 42464] gi|347011126|gb|AEO58611.1| hypothetical protein MYCTH_2127657 [Myceliophthora thermophila ATCC 42464] Length = 162 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/70 (38%), Positives = 40/70 (57%) Frame = +3 Query: 111 GPCDVESDSCRAVINASACFNEFMAIGNKNSMLNCLAGTDGSATPQQKLCACTGCLGPAM 290 GPCD S++CR VI A+ACF ++ G K +L C+ D A ++ +CAC GC A+ Sbjct: 89 GPCDAYSEACRPVIQANACFAAYIVFGTKEQVLQCVDVND-LAKAEEAICACYGCAEQAV 147 Query: 291 INWINKNQAC 320 +W + C Sbjct: 148 QDWAVETLGC 157 >ref|XP_003304894.1| hypothetical protein PTT_17622 [Pyrenophora teres f. teres 0-1] gi|311318285|gb|EFQ87024.1| hypothetical protein PTT_17622 [Pyrenophora teres f. teres 0-1] Length = 89 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = +3 Query: 69 LSLLFIYISSALADGPCDV-ESDSCRAVINASACFNEFMAIGNKNSMLNCLAGTDGSATP 245 LSL+ I + + +V ++D C AVINA+AC+N+F + L C+ G D + Sbjct: 9 LSLITIVFAQIYPECTAEVAQTDDCAAVINANACYNKFRW---NSQTLTCIDG-DNNTVK 64 Query: 246 QQKLCACTGCLGPAMINWINKNQAC 320 Q+++CAC C+G M +W K + C Sbjct: 65 QRQVCACCSCVGKVMCDWATKQKFC 89 >ref|XP_003664830.1| hypothetical protein MYCTH_2040301, partial [Myceliophthora thermophila ATCC 42464] gi|347012101|gb|AEO59585.1| hypothetical protein MYCTH_2040301, partial [Myceliophthora thermophila ATCC 42464] Length = 72 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/66 (36%), Positives = 38/66 (57%) Frame = +3 Query: 123 VESDSCRAVINASACFNEFMAIGNKNSMLNCLAGTDGSATPQQKLCACTGCLGPAMINWI 302 + +D C AVIN +AC+N+F L+C+ G D A +++ C C C+G M NW+ Sbjct: 11 IRTDDCAAVINPTACYNQFRWTSRT---LSCIDGVD-DAERKRRACLCCSCVGDVMCNWV 66 Query: 303 NKNQAC 320 +N+ C Sbjct: 67 RQNRFC 72