BLASTX nr result
ID: Akebia27_contig00026905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026905 (698 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048237.1| BolA-like family protein isoform 1 [Theobrom... 57 6e-06 gb|AEC10959.1| bola-like family protein [Camellia sinensis] 57 6e-06 ref|XP_002282721.1| PREDICTED: uncharacterized protein LOC100245... 57 6e-06 ref|XP_002300203.2| hypothetical protein POPTR_0001s31670g [Popu... 57 8e-06 gb|ADB85099.1| putative transcription regulator [Jatropha curcas] 57 8e-06 >ref|XP_007048237.1| BolA-like family protein isoform 1 [Theobroma cacao] gi|508700498|gb|EOX92394.1| BolA-like family protein isoform 1 [Theobroma cacao] Length = 89 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 605 PSMQEVIDTSGGCGASFAIEIVSEAFEGKRL 697 PS EVIDTSGGCGASFAIEIVSE FEGKRL Sbjct: 18 PSHLEVIDTSGGCGASFAIEIVSEQFEGKRL 48 >gb|AEC10959.1| bola-like family protein [Camellia sinensis] Length = 90 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 605 PSMQEVIDTSGGCGASFAIEIVSEAFEGKRL 697 PS EVIDTSGGCGASFAIEIVSE FEGKRL Sbjct: 18 PSHLEVIDTSGGCGASFAIEIVSEKFEGKRL 48 >ref|XP_002282721.1| PREDICTED: uncharacterized protein LOC100245396 isoform 1 [Vitis vinifera] gi|296088614|emb|CBI37605.3| unnamed protein product [Vitis vinifera] Length = 93 Score = 57.0 bits (136), Expect = 6e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 605 PSMQEVIDTSGGCGASFAIEIVSEAFEGKRL 697 PS EVIDTSGGCGASFAIEIVSE FEGKRL Sbjct: 18 PSHLEVIDTSGGCGASFAIEIVSEQFEGKRL 48 >ref|XP_002300203.2| hypothetical protein POPTR_0001s31670g [Populus trichocarpa] gi|550348652|gb|EEE85008.2| hypothetical protein POPTR_0001s31670g [Populus trichocarpa] Length = 93 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 605 PSMQEVIDTSGGCGASFAIEIVSEAFEGKRL 697 PS EV+DTSGGCGASFAIEIVSE FEGKRL Sbjct: 18 PSHLEVVDTSGGCGASFAIEIVSEQFEGKRL 48 >gb|ADB85099.1| putative transcription regulator [Jatropha curcas] Length = 93 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 605 PSMQEVIDTSGGCGASFAIEIVSEAFEGKRL 697 PS EVIDTSGGCGASFA+EIVSE FEGKRL Sbjct: 18 PSHLEVIDTSGGCGASFAVEIVSEQFEGKRL 48