BLASTX nr result
ID: Akebia27_contig00026761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026761 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029728.1| NB-ARC domain-containing disease resistance ... 56 5e-06 >ref|XP_007029728.1| NB-ARC domain-containing disease resistance protein, putative [Theobroma cacao] gi|508718333|gb|EOY10230.1| NB-ARC domain-containing disease resistance protein, putative [Theobroma cacao] Length = 2516 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/100 (33%), Positives = 45/100 (45%) Frame = +2 Query: 8 NELPDSFFESMTSLVTLNLERTAVXXXXXXXXXXXXXXXXXXDFTLVSDISMVGNLKKLE 187 +E+PD+FFE M L L L DF +SDI+++ NLKKL+ Sbjct: 583 SEVPDTFFEKMNDLQVLQLNGMRFPSLPSSFLSLTNLQTLCLDFCALSDIALIANLKKLD 642 Query: 188 MLSLIGTLIKMLPKEXXXXXXXXXXXXSKAWYLETIAKNV 307 +LSL + IK LP E S + LE I N+ Sbjct: 643 ILSLCSSKIKQLPNEIAQLTQLRLLDLSNCFKLEVIPANI 682