BLASTX nr result
ID: Akebia27_contig00026680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026680 (915 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515687.1| conserved hypothetical protein [Ricinus comm... 64 6e-08 >ref|XP_002515687.1| conserved hypothetical protein [Ricinus communis] gi|223545124|gb|EEF46634.1| conserved hypothetical protein [Ricinus communis] Length = 85 Score = 64.3 bits (155), Expect = 6e-08 Identities = 38/96 (39%), Positives = 53/96 (55%) Frame = +3 Query: 624 AMRLGVVVFLIGCLLILESIGSDAVAREIFFNGRSVAEKEILNSNGSNVEGVHVKRCKGR 803 AMRL ++ ++ C+LI SI SDAV ++ FF +++ +SN +E V+ Sbjct: 3 AMRLPILAIVLYCVLIFASIRSDAVPKKAFFFSNDGNKRKNTSSN-EPIEAVN------- 54 Query: 804 KIDFCDYFSPLKNNHKNNTLDDKRVVPTGPNPLHNR 911 YF + N T D+KRVVPTGPNPLHNR Sbjct: 55 -----GYFCNKGTKNSNKTSDEKRVVPTGPNPLHNR 85