BLASTX nr result
ID: Akebia27_contig00026393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026393 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338855.1| PREDICTED: arginyl-tRNA--protein transferase... 63 4e-08 ref|XP_004240947.1| PREDICTED: arginyl-tRNA--protein transferase... 60 3e-07 ref|XP_007009019.1| Arginine-tRNA protein transferase 1, putativ... 57 3e-06 >ref|XP_006338855.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Solanum tuberosum] Length = 640 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 385 RMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMV 269 R+R+KDL+QAFGS E Y+E+QLHRYM+AVG+ LSERMV Sbjct: 598 RLRYKDLRQAFGSGERRYMETQLHRYMRAVGAELSERMV 636 >ref|XP_004240947.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Solanum lycopersicum] Length = 640 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -1 Query: 385 RMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMV 269 R+R+KDL+QAFGS E ++E+QLH+YM+AVG+ LSERMV Sbjct: 598 RLRYKDLRQAFGSRERRFMETQLHKYMRAVGAELSERMV 636 >ref|XP_007009019.1| Arginine-tRNA protein transferase 1, putative isoform 1 [Theobroma cacao] gi|508725932|gb|EOY17829.1| Arginine-tRNA protein transferase 1, putative isoform 1 [Theobroma cacao] Length = 628 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 388 NRMRFKDLQQAFGSSENNYLESQLHRYMKAVGSGLSERMV 269 +R+R+KDLQ AFG +E NYLE QLH Y + VG LSERMV Sbjct: 585 SRLRYKDLQPAFGPTERNYLEMQLHNYQRVVGLELSERMV 624