BLASTX nr result
ID: Akebia27_contig00026353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026353 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putati... 57 4e-06 gb|ABK21242.1| unknown [Picea sitchensis] gi|294463295|gb|ADE771... 56 5e-06 gb|EXB54905.1| Ubiquitin-conjugating enzyme E2 27 [Morus notabilis] 55 8e-06 ref|XP_002459014.1| hypothetical protein SORBIDRAFT_03g044480 [S... 55 8e-06 >ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis] gi|223550232|gb|EEF51719.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis] Length = 194 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 LVEMGFPEVLVRKTLEIVGGDENMALEKLCSG 98 LVEMGFPE LVR TLE V GDEN+ALEKLCSG Sbjct: 163 LVEMGFPEGLVRSTLEAVSGDENLALEKLCSG 194 >gb|ABK21242.1| unknown [Picea sitchensis] gi|294463295|gb|ADE77183.1| unknown [Picea sitchensis] Length = 195 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 LVEMGFPEVLVRKTLEIVGGDENMALEKLCSG 98 LVEMGFPE +VR TLE GGDENMALEKLCSG Sbjct: 164 LVEMGFPEDMVRTTLEQCGGDENMALEKLCSG 195 >gb|EXB54905.1| Ubiquitin-conjugating enzyme E2 27 [Morus notabilis] Length = 195 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 LVEMGFPEVLVRKTLEIVGGDENMALEKLCSG 98 LVEMGFPE R TLE VGGDEN+ALEKLCSG Sbjct: 164 LVEMGFPEAQARTTLESVGGDENLALEKLCSG 195 >ref|XP_002459014.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor] gi|241930989|gb|EES04134.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor] Length = 195 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 LVEMGFPEVLVRKTLEIVGGDENMALEKLCSG 98 LVEMGFPE LVR TL+ V GDENMALEKLCSG Sbjct: 164 LVEMGFPEDLVRSTLKSVDGDENMALEKLCSG 195