BLASTX nr result
ID: Akebia27_contig00026326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026326 (1833 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 45 3e-08 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 45.1 bits (105), Expect(2) = 3e-08 Identities = 23/67 (34%), Positives = 40/67 (59%) Frame = -3 Query: 1663 QGL*NS*NQERVDEYKFSIDT*EKKCLVKIDGLEIP*NDHFHYLRSIIHKDGEIEKDVTQ 1484 +GL S ++ E KFS + + + V+I EIP +D F YL SI+ K+GE+++D+ Sbjct: 425 KGLCLSRSKTEYMECKFSANGSQNELGVRIGDQEIPKSDRFRYLGSILQKNGELDEDLNH 484 Query: 1483 KTKVAWL 1463 + + W+ Sbjct: 485 RIQAGWM 491 Score = 42.0 bits (97), Expect(2) = 3e-08 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = -2 Query: 1478 QSCMVKWRCASSVLCDRHKPIKLK*KNYRAIERPS 1374 Q+ +KW+ AS VLCDR P+KLK K YR RP+ Sbjct: 487 QAGWMKWKSASGVLCDRRMPLKLKGKFYRTAIRPA 521