BLASTX nr result
ID: Akebia27_contig00026249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00026249 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342091.1| PREDICTED: mechanosensitive ion channel prot... 87 3e-15 ref|XP_004238626.1| PREDICTED: mechanosensitive ion channel prot... 87 3e-15 gb|EYU17549.1| hypothetical protein MIMGU_mgv1a022063mg, partial... 83 5e-14 ref|XP_004253205.1| PREDICTED: mechanosensitive ion channel prot... 82 6e-14 ref|XP_006383755.1| hypothetical protein POPTR_0005s26790g [Popu... 81 1e-13 ref|XP_007200320.1| hypothetical protein PRUPE_ppa001020mg [Prun... 81 1e-13 ref|XP_006342705.1| PREDICTED: mechanosensitive ion channel prot... 81 2e-13 gb|ADE76378.1| unknown [Picea sitchensis] 81 2e-13 ref|XP_006828866.1| hypothetical protein AMTR_s00001p00171160 [A... 80 3e-13 ref|XP_007221959.1| hypothetical protein PRUPE_ppa001779mg [Prun... 80 3e-13 ref|XP_006486674.1| PREDICTED: mechanosensitive ion channel prot... 79 9e-13 ref|XP_006422520.1| hypothetical protein CICLE_v10027767mg [Citr... 79 9e-13 ref|XP_007017928.1| Mechanosensitive ion channel domain-containi... 78 1e-12 ref|XP_006377732.1| hypothetical protein POPTR_0011s10680g [Popu... 77 2e-12 ref|XP_006370070.1| hypothetical protein POPTR_0001s39270g [Popu... 77 3e-12 ref|XP_004292928.1| PREDICTED: mechanosensitive ion channel prot... 77 3e-12 ref|XP_007021979.1| Mechanosensitive channel of small conductanc... 76 4e-12 gb|EXC19952.1| hypothetical protein L484_002633 [Morus notabilis] 76 6e-12 gb|EXB63953.1| hypothetical protein L484_003336 [Morus notabilis] 76 6e-12 gb|EXB24046.1| Mechanosensitive ion channel protein 8 [Morus not... 76 6e-12 >ref|XP_006342091.1| PREDICTED: mechanosensitive ion channel protein 8-like [Solanum tuberosum] Length = 876 Score = 86.7 bits (213), Expect = 3e-15 Identities = 36/50 (72%), Positives = 47/50 (94%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 GERW RRALL+EEM+KIFR+LDIEYR+LP DVNVRN+P ++S+++PSNW+ Sbjct: 824 GERWARRALLIEEMVKIFRELDIEYRMLPLDVNVRNMPQISSSRVPSNWS 873 >ref|XP_004238626.1| PREDICTED: mechanosensitive ion channel protein 8-like [Solanum lycopersicum] Length = 876 Score = 86.7 bits (213), Expect = 3e-15 Identities = 36/50 (72%), Positives = 47/50 (94%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 GERW RRALL+EEM+KIFR+LDIEYR+LP DVNVRN+P ++S+++PSNW+ Sbjct: 824 GERWARRALLIEEMVKIFRELDIEYRMLPLDVNVRNMPQISSSRVPSNWS 873 >gb|EYU17549.1| hypothetical protein MIMGU_mgv1a022063mg, partial [Mimulus guttatus] Length = 742 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 GERW RR LLVE M+K FR+LDIEYRLLP DVNVRN+P ++S ++PSNWT Sbjct: 688 GERWSRRGLLVEHMVKTFRELDIEYRLLPLDVNVRNMPPISSNRVPSNWT 737 >ref|XP_004253205.1| PREDICTED: mechanosensitive ion channel protein 8-like [Solanum lycopersicum] Length = 1175 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 GERW RRALL+EEM+K FR+LDI+YR+LP D+N+ NLP L+ T+ PSNWT Sbjct: 1123 GERWARRALLIEEMVKTFRELDIQYRMLPLDINIHNLPPLSLTRAPSNWT 1172 >ref|XP_006383755.1| hypothetical protein POPTR_0005s26790g [Populus trichocarpa] gi|550339808|gb|ERP61552.1| hypothetical protein POPTR_0005s26790g [Populus trichocarpa] Length = 828 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = +2 Query: 5 ERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWTALSS 163 ERWVRR LL+ EMIK+F++LDIEYR+LP DVN+RN+P L S +LPSNWT ++ Sbjct: 776 ERWVRRNLLLGEMIKVFKELDIEYRVLPLDVNIRNMPPLVSNRLPSNWTTCAN 828 >ref|XP_007200320.1| hypothetical protein PRUPE_ppa001020mg [Prunus persica] gi|462395720|gb|EMJ01519.1| hypothetical protein PRUPE_ppa001020mg [Prunus persica] Length = 933 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/54 (66%), Positives = 47/54 (87%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWTALSS 163 GERWVRRA +VEEM++IF++LDI+YRLLP D+NVR +P +T QLPSN+TA +S Sbjct: 880 GERWVRRAYVVEEMVRIFQELDIQYRLLPLDINVRAMPPMTGGQLPSNFTATTS 933 >ref|XP_006342705.1| PREDICTED: mechanosensitive ion channel protein 8-like [Solanum tuberosum] Length = 758 Score = 80.9 bits (198), Expect = 2e-13 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +2 Query: 5 ERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 ERW RRA L+EEM+K FR+LDI+YR+LP D+N+ NLP L+ST+ PSNWT Sbjct: 707 ERWARRAFLIEEMVKTFRELDIQYRMLPLDINIHNLPPLSSTRAPSNWT 755 >gb|ADE76378.1| unknown [Picea sitchensis] Length = 290 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNW 148 GE+W+RR+ LVEEMI IFRDLDIEYRLLP DVN+R +PA+TS++LPS W Sbjct: 241 GEKWLRRSRLVEEMINIFRDLDIEYRLLPRDVNLRTMPAVTSSRLPSTW 289 >ref|XP_006828866.1| hypothetical protein AMTR_s00001p00171160 [Amborella trichopoda] gi|548833845|gb|ERM96282.1| hypothetical protein AMTR_s00001p00171160 [Amborella trichopoda] Length = 904 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 GERWVRRA VEEMI+I RDL+IEYR+LP DVN+R +P +TST+LPS WT Sbjct: 852 GERWVRRAQFVEEMIRICRDLEIEYRMLPVDVNLRPMPQITSTRLPSTWT 901 >ref|XP_007221959.1| hypothetical protein PRUPE_ppa001779mg [Prunus persica] gi|462418895|gb|EMJ23158.1| hypothetical protein PRUPE_ppa001779mg [Prunus persica] Length = 766 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +2 Query: 8 RWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 RW RR+LL+E MI++FR+LDIEYRLLP DVNVRN+P+LTS +LPS WT Sbjct: 709 RWTRRSLLIEAMIQVFRELDIEYRLLPLDVNVRNMPSLTSNKLPSIWT 756 >ref|XP_006486674.1| PREDICTED: mechanosensitive ion channel protein 6-like [Citrus sinensis] Length = 938 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/51 (68%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPA-LTSTQLPSNWT 151 GERW RRALLVEEM+KIFR+LDI+YRL P D+NVR++PA + S ++PS+WT Sbjct: 882 GERWTRRALLVEEMVKIFRELDIQYRLFPLDINVRSVPAPIVSERMPSSWT 932 >ref|XP_006422520.1| hypothetical protein CICLE_v10027767mg [Citrus clementina] gi|557524454|gb|ESR35760.1| hypothetical protein CICLE_v10027767mg [Citrus clementina] Length = 937 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/51 (68%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPA-LTSTQLPSNWT 151 GERW RRALLVEEM+KIFR+LDI+YRL P D+NVR++PA + S ++PS+WT Sbjct: 881 GERWTRRALLVEEMVKIFRELDIQYRLFPLDINVRSVPAPIVSERMPSSWT 931 >ref|XP_007017928.1| Mechanosensitive ion channel domain-containing protein, putative [Theobroma cacao] gi|508723256|gb|EOY15153.1| Mechanosensitive ion channel domain-containing protein, putative [Theobroma cacao] Length = 799 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = +2 Query: 5 ERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWTALSS 163 ERW RR L+EE IKI +DLDIEYRLLP DVNVRN+P L S +LPSNW A +S Sbjct: 747 ERWGRRGHLLEETIKILKDLDIEYRLLPLDVNVRNMPTLVSHRLPSNWIACTS 799 >ref|XP_006377732.1| hypothetical protein POPTR_0011s10680g [Populus trichocarpa] gi|550328118|gb|ERP55529.1| hypothetical protein POPTR_0011s10680g [Populus trichocarpa] Length = 895 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/51 (64%), Positives = 47/51 (92%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWTA 154 GER+VRR+LL++EM++IFR+LD++YRLLP D+NVR LP +TS +LP+NWT+ Sbjct: 845 GERFVRRSLLLDEMMRIFRELDMQYRLLPLDINVRALPPVTSDRLPANWTS 895 >ref|XP_006370070.1| hypothetical protein POPTR_0001s39270g [Populus trichocarpa] gi|550349249|gb|ERP66639.1| hypothetical protein POPTR_0001s39270g [Populus trichocarpa] Length = 808 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/50 (66%), Positives = 45/50 (90%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWT 151 GER++RR+LL++EM+KIFR+LDI+YRLLP D+NVR LP + S +LP+NWT Sbjct: 758 GERFIRRSLLLDEMMKIFRELDIQYRLLPLDINVRALPPVMSDRLPANWT 807 >ref|XP_004292928.1| PREDICTED: mechanosensitive ion channel protein 8-like [Fragaria vesca subsp. vesca] Length = 1287 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +2 Query: 5 ERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWTA 154 ERW RRALL+E M+K+F++LDI+YRLLP DVNVRN+P+ TS + PSNWTA Sbjct: 1236 ERWSRRALLIEAMVKVFKELDIQYRLLPIDVNVRNMPSSTS-KPPSNWTA 1284 >ref|XP_007021979.1| Mechanosensitive channel of small conductance-like 6, putative [Theobroma cacao] gi|508721607|gb|EOY13504.1| Mechanosensitive channel of small conductance-like 6, putative [Theobroma cacao] Length = 898 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPSNWTALSS 163 GERW RRALLVEEM+KIF DLDI+YRL P D+NV ++P + S +LP WT +S Sbjct: 845 GERWARRALLVEEMVKIFNDLDIKYRLYPIDINVCSMPPVASDRLPPKWTGPAS 898 >gb|EXC19952.1| hypothetical protein L484_002633 [Morus notabilis] Length = 139 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPS 142 GERW RRALLVEEMIK+FR+LDIEYR+LP DVNVR+LP+ S PS Sbjct: 81 GERWTRRALLVEEMIKVFRELDIEYRMLPLDVNVRSLPSCNSDDSPS 127 >gb|EXB63953.1| hypothetical protein L484_003336 [Morus notabilis] Length = 201 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPALTSTQLPS 142 GERW RRALLVEEMIK+FR+LDIEYR+LP DVNVR+LP+ S PS Sbjct: 143 GERWTRRALLVEEMIKVFRELDIEYRMLPLDVNVRSLPSCNSDDSPS 189 >gb|EXB24046.1| Mechanosensitive ion channel protein 8 [Morus notabilis] Length = 946 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/58 (60%), Positives = 48/58 (82%), Gaps = 4/58 (6%) Frame = +2 Query: 2 GERWVRRALLVEEMIKIFRDLDIEYRLLPCDVNVRNLPAL----TSTQLPSNWTALSS 163 GER+ RR+LL+EEM+KIF++LDI+YRLLP D+NVR +P++ TST LP NWTA ++ Sbjct: 889 GERYARRSLLIEEMVKIFQELDIQYRLLPIDINVRAMPSVAPVPTSTWLPPNWTATTT 946