BLASTX nr result
ID: Akebia27_contig00025660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00025660 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citr... 57 3e-06 >ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina] gi|568835980|ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform X1 [Citrus sinensis] gi|557535460|gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina] Length = 874 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -1 Query: 104 KCQDGK-KKIKGSVVLMKKNALDFNDFKASFEDRF 3 KC+ GK KKIKG+VVLMKKN LDFNDF ASF DRF Sbjct: 26 KCEKGKCKKIKGTVVLMKKNVLDFNDFNASFLDRF 60