BLASTX nr result
ID: Akebia27_contig00025440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00025440 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49751.1| hypothetical protein DOTSEDRAFT_68508 [Dothistrom... 76 4e-12 gb|EMD00531.1| hypothetical protein BAUCODRAFT_172695 [Baudoinia... 69 9e-10 gb|EME89421.1| hypothetical protein MYCFIDRAFT_55836 [Pseudocerc... 66 6e-09 ref|XP_003856456.1| hypothetical protein MYCGRDRAFT_98637 [Zymos... 66 6e-09 gb|EMF17432.1| hypothetical protein SEPMUDRAFT_32096 [Sphaerulin... 64 2e-08 >gb|EME49751.1| hypothetical protein DOTSEDRAFT_68508 [Dothistroma septosporum NZE10] Length = 208 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +3 Query: 231 ENWDSMTEEQKKATFDKLPEDQKK-MGYMEWLSQGYQHKKENWMPW 365 E W++MTE QKK T++ LP DQKK YMEW+S+GYQH+KENWMPW Sbjct: 21 EKWNAMTEHQKKETYNSLPNDQKKGKTYMEWISEGYQHQKENWMPW 66 >gb|EMD00531.1| hypothetical protein BAUCODRAFT_172695 [Baudoinia compniacensis UAMH 10762] Length = 203 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 231 ENWDSMTEEQKKATFDKLPEDQKK-MGYMEWLSQGYQHKKENWMPW 365 + W++M+EEQKK TFD LP +QKK Y+EW+ +GY H+ ENWMPW Sbjct: 24 KKWEAMSEEQKKHTFDNLPAEQKKGKTYVEWIQEGYHHQYENWMPW 69 >gb|EME89421.1| hypothetical protein MYCFIDRAFT_55836 [Pseudocercospora fijiensis CIRAD86] Length = 184 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/41 (65%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +3 Query: 246 MTEEQKKATFDKLPEDQKK-MGYMEWLSQGYQHKKENWMPW 365 M+EEQKK TFD LPE++K+ Y EW+ +GYQH+KENWMPW Sbjct: 1 MSEEQKKQTFDALPEEKKQGKTYTEWIKEGYQHQKENWMPW 41 >ref|XP_003856456.1| hypothetical protein MYCGRDRAFT_98637 [Zymoseptoria tritici IPO323] gi|339476341|gb|EGP91432.1| hypothetical protein MYCGRDRAFT_98637 [Zymoseptoria tritici IPO323] Length = 170 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/41 (65%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +3 Query: 246 MTEEQKKATFDKLPEDQKK-MGYMEWLSQGYQHKKENWMPW 365 M++EQKKATF+ LPEDQK+ YMEW+ +GYQ++ ENWMPW Sbjct: 1 MSDEQKKATFNALPEDQKRGKSYMEWIKEGYQNQYENWMPW 41 >gb|EMF17432.1| hypothetical protein SEPMUDRAFT_32096 [Sphaerulina musiva SO2202] Length = 166 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/41 (60%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +3 Query: 246 MTEEQKKATFDKLPEDQKK-MGYMEWLSQGYQHKKENWMPW 365 M+E+QK+ TFD LPE++K+ Y EW+++GYQH+KENWMPW Sbjct: 1 MSEDQKQQTFDALPEEKKQGKSYSEWIAEGYQHQKENWMPW 41