BLASTX nr result
ID: Akebia27_contig00025437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00025437 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303430.1| hypothetical protein POPTR_0003s09390g [Popu... 82 8e-14 ref|XP_006485493.1| PREDICTED: phosphatidylinositol-glycan biosy... 79 5e-13 ref|XP_006485490.1| PREDICTED: phosphatidylinositol-glycan biosy... 79 5e-13 ref|XP_006445800.1| hypothetical protein CICLE_v100160331mg, par... 79 5e-13 ref|XP_002278687.1| PREDICTED: uncharacterized protein LOC100252... 72 6e-11 emb|CAN75134.1| hypothetical protein VITISV_018886 [Vitis vinifera] 72 6e-11 ref|XP_007040663.1| Phosphatidylinositol-glycan biosynthesis cla... 70 2e-10 ref|XP_007209359.1| hypothetical protein PRUPE_ppa008727mg [Prun... 70 3e-10 ref|XP_003628750.1| Phosphatidylinositol-glycan biosynthesis cla... 69 7e-10 ref|XP_003628749.1| Phosphatidylinositol-glycan biosynthesis cla... 69 7e-10 ref|XP_004509748.1| PREDICTED: phosphatidylinositol-glycan biosy... 65 7e-09 ref|XP_003527241.1| PREDICTED: phosphatidylinositol-glycan biosy... 65 7e-09 ref|XP_006352891.1| PREDICTED: uncharacterized protein LOC102580... 64 2e-08 ref|XP_004246191.1| PREDICTED: uncharacterized protein LOC101263... 62 6e-08 ref|XP_004509750.1| PREDICTED: phosphatidylinositol-glycan biosy... 60 4e-07 ref|XP_006398379.1| hypothetical protein EUTSA_v10000976mg [Eutr... 59 5e-07 ref|XP_004150217.1| PREDICTED: phosphatidylinositol-glycan biosy... 59 5e-07 ref|XP_007135992.1| hypothetical protein PHAVU_009G009200g [Phas... 59 7e-07 ref|NP_001067189.1| Os12g0596900 [Oryza sativa Japonica Group] g... 59 7e-07 gb|EEC69607.1| hypothetical protein OsI_38979 [Oryza sativa Indi... 59 7e-07 >ref|XP_002303430.1| hypothetical protein POPTR_0003s09390g [Populus trichocarpa] gi|118488795|gb|ABK96208.1| unknown [Populus trichocarpa] gi|222840862|gb|EEE78409.1| hypothetical protein POPTR_0003s09390g [Populus trichocarpa] Length = 315 Score = 82.0 bits (201), Expect = 8e-14 Identities = 41/71 (57%), Positives = 52/71 (73%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD +GYSEVE P++FLRCS+E EN HESCL M + S T ++VWRIPSG AH Sbjct: 219 PLDDSGYSEVEFGEPEIFLRCSME-ENGDHESCLLMPTNDRTGSRTDNVVWRIPSGIRAH 277 Query: 194 SGVVSIVTFIS 162 +G+VS VTF++ Sbjct: 278 AGIVSAVTFLA 288 >ref|XP_006485493.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X4 [Citrus sinensis] Length = 258 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD++GYS+VE+ PDLFLRC IE + L ++SCL++ ++E T VWRIPSG +H Sbjct: 162 PLDESGYSQVELGDPDLFLRCCIEGK-LQNQSCLFISTSENAERKTGRAVWRIPSGIKSH 220 Query: 194 SGVVSIVTFIS 162 G VS+VTF+S Sbjct: 221 GGFVSVVTFVS 231 >ref|XP_006485490.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X1 [Citrus sinensis] gi|568864191|ref|XP_006485491.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X2 [Citrus sinensis] gi|568864193|ref|XP_006485492.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X3 [Citrus sinensis] Length = 329 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD++GYS+VE+ PDLFLRC IE + L ++SCL++ ++E T VWRIPSG +H Sbjct: 233 PLDESGYSQVELGDPDLFLRCCIEGK-LQNQSCLFISTSENAERKTGRAVWRIPSGIKSH 291 Query: 194 SGVVSIVTFIS 162 G VS+VTF+S Sbjct: 292 GGFVSVVTFVS 302 >ref|XP_006445800.1| hypothetical protein CICLE_v100160331mg, partial [Citrus clementina] gi|557548411|gb|ESR59040.1| hypothetical protein CICLE_v100160331mg, partial [Citrus clementina] Length = 97 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD++GYS+VE+ PDLFLRC IE + L ++SCL++ ++E T VWRIPSG +H Sbjct: 1 PLDESGYSQVELGDPDLFLRCCIEGK-LQNQSCLFISTSENAERKTGRAVWRIPSGIKSH 59 Query: 194 SGVVSIVTFIS 162 G VS+VTF+S Sbjct: 60 GGFVSVVTFVS 70 >ref|XP_002278687.1| PREDICTED: uncharacterized protein LOC100252266 [Vitis vinifera] gi|297742059|emb|CBI33846.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/71 (49%), Positives = 49/71 (69%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+++GYS +E+ PDLF+RCSIE ++ ++SCL M+ +VWR+PSG AH Sbjct: 233 PLEESGYSNIELGAPDLFMRCSIEAKS-HNQSCLLMLKDNGVALGNGPVVWRVPSGIKAH 291 Query: 194 SGVVSIVTFIS 162 + VSIVTFIS Sbjct: 292 ARAVSIVTFIS 302 >emb|CAN75134.1| hypothetical protein VITISV_018886 [Vitis vinifera] Length = 334 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/71 (49%), Positives = 49/71 (69%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+++GYS +E+ PDLF+RCSIE ++ ++SCL M+ +VWR+PSG AH Sbjct: 238 PLEESGYSNIELGAPDLFMRCSIEAKS-HNQSCLLMLKDNGVALGNGPVVWRVPSGIKAH 296 Query: 194 SGVVSIVTFIS 162 + VSIVTFIS Sbjct: 297 ARAVSIVTFIS 307 >ref|XP_007040663.1| Phosphatidylinositol-glycan biosynthesis class X protein, putative [Theobroma cacao] gi|508777908|gb|EOY25164.1| Phosphatidylinositol-glycan biosynthesis class X protein, putative [Theobroma cacao] Length = 313 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/69 (47%), Positives = 49/69 (71%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD++GYS VE+ PD+ + CS+E ++ +SCL+M ++S T ++ WRIPSG AH Sbjct: 217 PLDESGYSIVEIGEPDVLMSCSMEGKHD-KQSCLYMSPHDSAKSRTGTVAWRIPSGKKAH 275 Query: 194 SGVVSIVTF 168 +G VS+VTF Sbjct: 276 AGFVSVVTF 284 >ref|XP_007209359.1| hypothetical protein PRUPE_ppa008727mg [Prunus persica] gi|462405094|gb|EMJ10558.1| hypothetical protein PRUPE_ppa008727mg [Prunus persica] Length = 321 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/72 (45%), Positives = 52/72 (72%), Gaps = 1/72 (1%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMM-MADSESNTSSIVWRIPSGNNA 198 PL++NGY EV+ +PDLF+RCS+E ++ ESCL+ + + S+ ++VW+IPSG Sbjct: 224 PLNENGYWEVKFGVPDLFMRCSVEGKS-HDESCLYKVSEITGSKLTYGTVVWKIPSGMKV 282 Query: 197 HSGVVSIVTFIS 162 H+G+VSI TF++ Sbjct: 283 HAGIVSIFTFVA 294 >ref|XP_003628750.1| Phosphatidylinositol-glycan biosynthesis class X protein [Medicago truncatula] gi|355522772|gb|AET03226.1| Phosphatidylinositol-glycan biosynthesis class X protein [Medicago truncatula] Length = 256 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/70 (47%), Positives = 48/70 (68%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+++GYS VE PD+ LRCS KE + + +CL+ + + D+ + +VWRIPSG AH Sbjct: 160 PLNESGYSIVEFGAPDMLLRCS-RKEKVENNNCLFRLKIDDANLYDAGLVWRIPSGRKAH 218 Query: 194 SGVVSIVTFI 165 S +VS VTF+ Sbjct: 219 SELVSAVTFL 228 >ref|XP_003628749.1| Phosphatidylinositol-glycan biosynthesis class X protein [Medicago truncatula] gi|355522771|gb|AET03225.1| Phosphatidylinositol-glycan biosynthesis class X protein [Medicago truncatula] Length = 368 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/70 (47%), Positives = 48/70 (68%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+++GYS VE PD+ LRCS KE + + +CL+ + + D+ + +VWRIPSG AH Sbjct: 272 PLNESGYSIVEFGAPDMLLRCS-RKEKVENNNCLFRLKIDDANLYDAGLVWRIPSGRKAH 330 Query: 194 SGVVSIVTFI 165 S +VS VTF+ Sbjct: 331 SELVSAVTFL 340 >ref|XP_004509748.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X1 [Cicer arietinum] gi|502154577|ref|XP_004509749.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X2 [Cicer arietinum] Length = 315 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/71 (45%), Positives = 46/71 (64%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+++GYS VE PD+ LRC KE + + CL+ + D+ +++VWRIPSG AH Sbjct: 219 PLNESGYSIVEFGAPDMLLRCRT-KEKVENNHCLFKLKNDDANLYDAAVVWRIPSGRKAH 277 Query: 194 SGVVSIVTFIS 162 S +VS VTF + Sbjct: 278 SDLVSTVTFFA 288 >ref|XP_003527241.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like [Glycine max] Length = 292 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/71 (45%), Positives = 47/71 (66%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+ +GYS +E PD+ +RCS KE + + +C + + D+ + IVWRIPSG AH Sbjct: 204 PLNGSGYSAIEFGAPDMVVRCST-KEKMENHNCFFKLEKDDANLYGAHIVWRIPSGIKAH 262 Query: 194 SGVVSIVTFIS 162 +G+VS VTFI+ Sbjct: 263 AGLVSAVTFIA 273 >ref|XP_006352891.1| PREDICTED: uncharacterized protein LOC102580422 [Solanum tuberosum] Length = 300 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/67 (43%), Positives = 45/67 (67%) Frame = -2 Query: 362 NGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAHSGVV 183 +G+S VE PDLFLRC++E++ CL+++ ++ES + +VW +P GN H+ VV Sbjct: 208 HGFSRVEFASPDLFLRCNVERKED-DTGCLFLLDKQNAESIDTQLVWEVPCGNREHTEVV 266 Query: 182 SIVTFIS 162 S +TFIS Sbjct: 267 SAITFIS 273 >ref|XP_004246191.1| PREDICTED: uncharacterized protein LOC101263445 [Solanum lycopersicum] Length = 182 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/67 (43%), Positives = 44/67 (65%) Frame = -2 Query: 362 NGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAHSGVV 183 +G+S VE PDLFLRC++E++ + CL+++ ++ES + VW +P GN H+ VV Sbjct: 101 HGFSRVEFASPDLFLRCNLERKE-YDTGCLFLLDKQNAESIDTHPVWEVPCGNREHTEVV 159 Query: 182 SIVTFIS 162 S TFIS Sbjct: 160 SAFTFIS 166 >ref|XP_004509750.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like isoform X3 [Cicer arietinum] Length = 295 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PL+++GYS VE PD+ LRC KE + + CL+ + D+ +++VWRIPSG AH Sbjct: 219 PLNESGYSIVEFGAPDMLLRCRT-KEKVENNHCLFKLKNDDANLYDAAVVWRIPSGRKAH 277 Query: 194 SGVVS 180 S +VS Sbjct: 278 SDLVS 282 >ref|XP_006398379.1| hypothetical protein EUTSA_v10000976mg [Eutrema salsugineum] gi|557099468|gb|ESQ39832.1| hypothetical protein EUTSA_v10000976mg [Eutrema salsugineum] Length = 296 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHES--CLWMMMMADSESNTSSIVWRIPSGNN 201 PL +GYS VE PDLFL CS N HE CL ++ + S++ T S+VW IP+G Sbjct: 199 PLGDSGYSRVEFGEPDLFL-CSSHVPNQQHEQRRCL-VLSIGGSKTETGSVVWEIPAGIR 256 Query: 200 AHSGVVSIVTFIS 162 +H+ VS++TF++ Sbjct: 257 SHTEYVSVLTFVA 269 >ref|XP_004150217.1| PREDICTED: phosphatidylinositol-glycan biosynthesis class X protein-like [Cucumis sativus] Length = 273 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/70 (41%), Positives = 46/70 (65%) Frame = -2 Query: 371 LDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAHS 192 LD++GY EV + PDLFL+CSI+ E + +C + + D E++ + W IP+G + + Sbjct: 185 LDESGYVEVRLKAPDLFLQCSIQ-EKPHNRTCFFRLETDDEEAD---LTWSIPAGKRSDA 240 Query: 191 GVVSIVTFIS 162 GVVS +TF+S Sbjct: 241 GVVSAITFVS 250 >ref|XP_007135992.1| hypothetical protein PHAVU_009G009200g [Phaseolus vulgaris] gi|593267631|ref|XP_007135993.1| hypothetical protein PHAVU_009G009200g [Phaseolus vulgaris] gi|561009079|gb|ESW07986.1| hypothetical protein PHAVU_009G009200g [Phaseolus vulgaris] gi|561009080|gb|ESW07987.1| hypothetical protein PHAVU_009G009200g [Phaseolus vulgaris] Length = 286 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/68 (42%), Positives = 42/68 (61%) Frame = -2 Query: 371 LDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAHS 192 L+++GYS VE PD+ +RCS KE + + C + + D+ S IVW+IPSG H+ Sbjct: 200 LNESGYSAVEFGAPDMLVRCST-KEKVENRYCFFKLEKGDANVYDSRIVWKIPSGIKTHA 258 Query: 191 GVVSIVTF 168 +VS VTF Sbjct: 259 NLVSTVTF 266 >ref|NP_001067189.1| Os12g0596900 [Oryza sativa Japonica Group] gi|77556402|gb|ABA99198.1| expressed protein [Oryza sativa Japonica Group] gi|113649696|dbj|BAF30208.1| Os12g0596900 [Oryza sativa Japonica Group] gi|215713476|dbj|BAG94613.1| unnamed protein product [Oryza sativa Japonica Group] gi|222617404|gb|EEE53536.1| hypothetical protein OsJ_36744 [Oryza sativa Japonica Group] Length = 289 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/71 (43%), Positives = 42/71 (59%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD +GY+ VE PDL LR K++ ESC W++ D+ + WRIP G+ AH Sbjct: 207 PLDASGYATVEFGSPDLLLR--YRKKDTVPESCSWLLKDLDA-APVEKATWRIPCGDEAH 263 Query: 194 SGVVSIVTFIS 162 G VS +TF+S Sbjct: 264 IGFVSSITFLS 274 >gb|EEC69607.1| hypothetical protein OsI_38979 [Oryza sativa Indica Group] Length = 289 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/71 (43%), Positives = 42/71 (59%) Frame = -2 Query: 374 PLDQNGYSEVEMCMPDLFLRCSIEKENLWHESCLWMMMMADSESNTSSIVWRIPSGNNAH 195 PLD +GY+ VE PDL LR K++ ESC W++ D+ + WRIP G+ AH Sbjct: 207 PLDASGYATVEFGSPDLLLR--YRKKDTVPESCSWLLKDLDA-APVEKATWRIPCGDEAH 263 Query: 194 SGVVSIVTFIS 162 G VS +TF+S Sbjct: 264 IGFVSSITFLS 274