BLASTX nr result
ID: Akebia27_contig00025287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00025287 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844260.1| hypothetical protein AMTR_s00145p00033710 [A... 57 2e-06 >ref|XP_006844260.1| hypothetical protein AMTR_s00145p00033710 [Amborella trichopoda] gi|548846669|gb|ERN05935.1| hypothetical protein AMTR_s00145p00033710 [Amborella trichopoda] Length = 324 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 226 MPPLISLEREFPIINPNFLHFCASHGIFSVEDF 324 MPPL SL+ +FP I+ N LHFCASHGIFSVEDF Sbjct: 1 MPPLKSLQHQFPSIDSNLLHFCASHGIFSVEDF 33