BLASTX nr result
ID: Akebia27_contig00025185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00025185 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB88943.1| protein phosphatase 2C [Mesembryanthemum crystal... 64 2e-08 >dbj|BAB88943.1| protein phosphatase 2C [Mesembryanthemum crystallinum] Length = 380 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = +3 Query: 270 NKCDGGADNDSSSEGRPPNPFAGAYRQSFS---VTSSCKKTLARHQSL 404 NK +GG +N SSSEGRPPNP A YRQ +S V+S+CKKTL RH SL Sbjct: 9 NKVNGGGENGSSSEGRPPNPLAATYRQCYSATRVSSTCKKTLMRHPSL 56