BLASTX nr result
ID: Akebia27_contig00025056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00025056 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307112.1| PREDICTED: putative amidohydrolase YtcJ-like... 55 1e-05 >ref|XP_004307112.1| PREDICTED: putative amidohydrolase YtcJ-like [Fragaria vesca subsp. vesca] Length = 567 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -2 Query: 99 IQMMQVQLRGVNSKDEFVRKVKEAVRDKHQGSW 1 +QMM+V+LRG+NSKDEFV++VKEAV++ QGSW Sbjct: 105 LQMMRVELRGINSKDEFVKRVKEAVKNAKQGSW 137