BLASTX nr result
ID: Akebia27_contig00024972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024972 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282444.2| PREDICTED: BTB/POZ domain-containing protein... 58 1e-06 emb|CAN63893.1| hypothetical protein VITISV_019664 [Vitis vinifera] 58 1e-06 ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein... 55 1e-05 ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein... 55 1e-05 >ref|XP_002282444.2| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Vitis vinifera] Length = 630 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 348 GVMRNSKLKTLCSIPARPKRMLSKLWSSNRSVNERH 241 G+ R+SKLK LCSIP RPKRMLSKLWS NRS +E++ Sbjct: 595 GIGRSSKLKALCSIPTRPKRMLSKLWSINRSASEKN 630 >emb|CAN63893.1| hypothetical protein VITISV_019664 [Vitis vinifera] Length = 619 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 348 GVMRNSKLKTLCSIPARPKRMLSKLWSSNRSVNERH 241 G+ R+SKLK LCSIP RPKRMLSKLWS NRS +E++ Sbjct: 584 GIGRSSKLKALCSIPTRPKRMLSKLWSINRSASEKN 619 >ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis sativus] Length = 627 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = -1 Query: 348 GVMRNSKLKTLCSIPARPKRMLSKLWSSNRSVNERH 241 G+ R+SK K LCS+P+RPKR+ SKLWS+NRS+ E++ Sbjct: 592 GISRSSKFKALCSLPSRPKRIFSKLWSANRSIMEKN 627 >ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis sativus] Length = 627 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = -1 Query: 348 GVMRNSKLKTLCSIPARPKRMLSKLWSSNRSVNERH 241 G+ R+SK K LCS+P+RPKR+ SKLWS+NRS+ E++ Sbjct: 592 GISRSSKFKALCSLPSRPKRIFSKLWSANRSIMEKN 627