BLASTX nr result
ID: Akebia27_contig00024938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024938 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45565.1| hypothetical protein MIMGU_mgv1a001885mg [Mimulus... 131 1e-28 gb|EYU43928.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus... 131 1e-28 gb|EPS73417.1| hypothetical protein M569_01333 [Genlisea aurea] 131 1e-28 ref|XP_004229226.1| PREDICTED: cullin-1-like [Solanum lycopersicum] 131 1e-28 emb|CAC87837.1| cullin 1C [Nicotiana tabacum] 131 1e-28 gb|ABB77428.1| cullin 1-like protein C [Petunia integrifolia sub... 131 1e-28 ref|XP_007226992.1| hypothetical protein PRUPE_ppa001901mg [Prun... 130 1e-28 emb|CCH26221.1| CUL1 protein [Pyrus x bretschneideri] 130 1e-28 gb|AFJ21665.1| cullin 1-like protein B [Prunus avium] 130 1e-28 ref|XP_002314453.2| cullin-like protein1 [Populus trichocarpa] g... 130 2e-28 ref|XP_006827698.1| hypothetical protein AMTR_s00009p00258510 [A... 130 2e-28 ref|XP_006380173.1| cullin-like protein1 [Populus trichocarpa] g... 130 2e-28 gb|EXB74807.1| hypothetical protein L484_023551 [Morus notabilis] 130 3e-28 ref|XP_002516899.1| Cullin-1, putative [Ricinus communis] gi|223... 129 3e-28 ref|XP_006419613.1| hypothetical protein CICLE_v10004406mg [Citr... 129 6e-28 ref|XP_007035551.1| Cullin 1 isoform 3 [Theobroma cacao] gi|5087... 129 6e-28 ref|XP_007035549.1| Cullin 1 isoform 1 [Theobroma cacao] gi|5087... 129 6e-28 ref|XP_004143085.1| PREDICTED: cullin-1-like [Cucumis sativus] g... 129 6e-28 ref|XP_002272195.1| PREDICTED: cullin-1 isoform 1 [Vitis vinifer... 129 6e-28 ref|XP_006645899.1| PREDICTED: cullin-1-like [Oryza brachyantha] 128 7e-28 >gb|EYU45565.1| hypothetical protein MIMGU_mgv1a001885mg [Mimulus guttatus] Length = 744 Score = 131 bits (329), Expect = 1e-28 Identities = 68/89 (76%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL YQ L MECVEQLG MFKPD K Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLFKYLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFKYLA 744 >gb|EYU43928.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus guttatus] gi|604345347|gb|EYU43929.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus guttatus] Length = 744 Score = 131 bits (329), Expect = 1e-28 Identities = 68/89 (76%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL YQ L MECVEQLG MFKPD K Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLFKYLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFKYLA 744 >gb|EPS73417.1| hypothetical protein M569_01333 [Genlisea aurea] Length = 744 Score = 131 bits (329), Expect = 1e-28 Identities = 68/89 (76%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL YQ L MECVEQLG MFKPD K Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLFKYLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFKYLA 744 >ref|XP_004229226.1| PREDICTED: cullin-1-like [Solanum lycopersicum] Length = 742 Score = 131 bits (329), Expect = 1e-28 Identities = 68/89 (76%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL YQ L MECVEQLG MFKPD K Sbjct: 654 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVK 713 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLFKYLA Sbjct: 714 AIKKRIEDLITRDYLERDKDNPNLFKYLA 742 >emb|CAC87837.1| cullin 1C [Nicotiana tabacum] Length = 447 Score = 131 bits (329), Expect = 1e-28 Identities = 68/89 (76%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL YQ L MECVEQLG MFKPD K Sbjct: 359 IPLPPEDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVK 418 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLFKYLA Sbjct: 419 AIKKRIEDLITRDYLERDKDNPNLFKYLA 447 >gb|ABB77428.1| cullin 1-like protein C [Petunia integrifolia subsp. inflata] Length = 742 Score = 131 bits (329), Expect = 1e-28 Identities = 68/89 (76%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL YQ L MECVEQLG MFKPD K Sbjct: 654 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGYQELVMECVEQLGRMFKPDVK 713 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLFKYLA Sbjct: 714 AIKKRIEDLITRDYLERDKDNPNLFKYLA 742 >ref|XP_007226992.1| hypothetical protein PRUPE_ppa001901mg [Prunus persica] gi|462423928|gb|EMJ28191.1| hypothetical protein PRUPE_ppa001901mg [Prunus persica] Length = 744 Score = 130 bits (328), Expect = 1e-28 Identities = 67/89 (75%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFRYLA 744 >emb|CCH26221.1| CUL1 protein [Pyrus x bretschneideri] Length = 744 Score = 130 bits (328), Expect = 1e-28 Identities = 67/89 (75%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFRYLA 744 >gb|AFJ21665.1| cullin 1-like protein B [Prunus avium] Length = 744 Score = 130 bits (328), Expect = 1e-28 Identities = 67/89 (75%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFRYLA 744 >ref|XP_002314453.2| cullin-like protein1 [Populus trichocarpa] gi|550328945|gb|EEF00624.2| cullin-like protein1 [Populus trichocarpa] Length = 744 Score = 130 bits (327), Expect = 2e-28 Identities = 67/89 (75%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK NPNLF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKENPNLFRYLA 744 >ref|XP_006827698.1| hypothetical protein AMTR_s00009p00258510 [Amborella trichopoda] gi|548832318|gb|ERM95114.1| hypothetical protein AMTR_s00009p00258510 [Amborella trichopoda] Length = 761 Score = 130 bits (327), Expect = 2e-28 Identities = 66/89 (74%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL+YQ L MECVEQLG MFKPDFK Sbjct: 673 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLSYQQLVMECVEQLGRMFKPDFK 732 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITR+YLERDK+NPN F+YLA Sbjct: 733 AIKKRIEDLITREYLERDKDNPNTFRYLA 761 >ref|XP_006380173.1| cullin-like protein1 [Populus trichocarpa] gi|550333694|gb|ERP57970.1| cullin-like protein1 [Populus trichocarpa] Length = 744 Score = 130 bits (327), Expect = 2e-28 Identities = 67/89 (75%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK NPNLF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKENPNLFRYLA 744 >gb|EXB74807.1| hypothetical protein L484_023551 [Morus notabilis] Length = 753 Score = 130 bits (326), Expect = 3e-28 Identities = 66/89 (74%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 665 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 724 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPN+F+YLA Sbjct: 725 AIKKRIEDLITRDYLERDKDNPNMFRYLA 753 >ref|XP_002516899.1| Cullin-1, putative [Ricinus communis] gi|223543987|gb|EEF45513.1| Cullin-1, putative [Ricinus communis] Length = 744 Score = 129 bits (325), Expect = 3e-28 Identities = 66/89 (74%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L +ECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVLECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPNLF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNLFRYLA 744 >ref|XP_006419613.1| hypothetical protein CICLE_v10004406mg [Citrus clementina] gi|568871886|ref|XP_006489110.1| PREDICTED: cullin-1-like isoform X1 [Citrus sinensis] gi|568871888|ref|XP_006489111.1| PREDICTED: cullin-1-like isoform X2 [Citrus sinensis] gi|557521486|gb|ESR32853.1| hypothetical protein CICLE_v10004406mg [Citrus clementina] Length = 744 Score = 129 bits (323), Expect = 6e-28 Identities = 65/89 (73%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L +ECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVLECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPN+F+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKSNPNMFRYLA 744 >ref|XP_007035551.1| Cullin 1 isoform 3 [Theobroma cacao] gi|508714580|gb|EOY06477.1| Cullin 1 isoform 3 [Theobroma cacao] Length = 693 Score = 129 bits (323), Expect = 6e-28 Identities = 66/89 (74%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 605 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 664 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPN F+YLA Sbjct: 665 AIKKRIEDLITRDYLERDKDNPNTFRYLA 693 >ref|XP_007035549.1| Cullin 1 isoform 1 [Theobroma cacao] gi|508714578|gb|EOY06475.1| Cullin 1 isoform 1 [Theobroma cacao] Length = 744 Score = 129 bits (323), Expect = 6e-28 Identities = 66/89 (74%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPN F+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNTFRYLA 744 >ref|XP_004143085.1| PREDICTED: cullin-1-like [Cucumis sativus] gi|449517495|ref|XP_004165781.1| PREDICTED: cullin-1-like [Cucumis sativus] Length = 744 Score = 129 bits (323), Expect = 6e-28 Identities = 66/89 (74%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NP+LF+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPHLFRYLA 744 >ref|XP_002272195.1| PREDICTED: cullin-1 isoform 1 [Vitis vinifera] gi|297736859|emb|CBI26060.3| unnamed protein product [Vitis vinifera] Length = 744 Score = 129 bits (323), Expect = 6e-28 Identities = 66/89 (74%), Positives = 69/89 (77%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 656 IPLPPVDEKKKVIEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 715 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPN F+YLA Sbjct: 716 AIKKRIEDLITRDYLERDKDNPNTFRYLA 744 >ref|XP_006645899.1| PREDICTED: cullin-1-like [Oryza brachyantha] Length = 766 Score = 128 bits (322), Expect = 7e-28 Identities = 65/89 (73%), Positives = 70/89 (78%) Frame = +2 Query: 2 IPLPPXXXXXXXXXXXXXXRRYAIDASIVRIMKSRKVLTYQHLSMECVEQLGYMFKPDFK 181 IPLPP RRYAIDASIVRIMKSRKVL +Q L MECVEQLG MFKPDFK Sbjct: 678 IPLPPVDEKKKVVEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFK 737 Query: 182 VIKKRIEDLITRDYLERDKNNPNLFKYLA 268 IKKRIEDLITRDYLERDK+NPN+++YLA Sbjct: 738 AIKKRIEDLITRDYLERDKDNPNVYRYLA 766