BLASTX nr result
ID: Akebia27_contig00024555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024555 (885 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006393637.1| hypothetical protein EUTSA_v10011725mg [Eutr... 58 6e-06 ref|XP_007017246.1| Photosystem I light harvesting complex gene ... 58 6e-06 ref|XP_007017245.1| Light-harvesting complex I protein Lhca5 iso... 58 6e-06 ref|XP_006374944.1| chlorophyll A-B binding family protein [Popu... 57 7e-06 >ref|XP_006393637.1| hypothetical protein EUTSA_v10011725mg [Eutrema salsugineum] gi|557090215|gb|ESQ30923.1| hypothetical protein EUTSA_v10011725mg [Eutrema salsugineum] Length = 255 Score = 57.8 bits (138), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 219 LCFFQLLRVTGISNLPVWYEAGAVKFEFASTRT 317 + F LLR TGISNLPVWYEAGAVKF+FAST+T Sbjct: 102 ILFTDLLRTTGISNLPVWYEAGAVKFDFASTKT 134 >ref|XP_007017246.1| Photosystem I light harvesting complex gene 5 isoform 2, partial [Theobroma cacao] gi|508722574|gb|EOY14471.1| Photosystem I light harvesting complex gene 5 isoform 2, partial [Theobroma cacao] Length = 247 Score = 57.8 bits (138), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 219 LCFFQLLRVTGISNLPVWYEAGAVKFEFASTRT 317 + F LLRVTGISNLPVWYEAGAVKF+FAST T Sbjct: 111 ILFTDLLRVTGISNLPVWYEAGAVKFDFASTGT 143 >ref|XP_007017245.1| Light-harvesting complex I protein Lhca5 isoform 1 [Theobroma cacao] gi|508722573|gb|EOY14470.1| Light-harvesting complex I protein Lhca5 isoform 1 [Theobroma cacao] Length = 264 Score = 57.8 bits (138), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 219 LCFFQLLRVTGISNLPVWYEAGAVKFEFASTRT 317 + F LLRVTGISNLPVWYEAGAVKF+FAST T Sbjct: 111 ILFTDLLRVTGISNLPVWYEAGAVKFDFASTGT 143 >ref|XP_006374944.1| chlorophyll A-B binding family protein [Populus trichocarpa] gi|550323257|gb|ERP52741.1| chlorophyll A-B binding family protein [Populus trichocarpa] Length = 266 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +3 Query: 219 LCFFQLLRVTGISNLPVWYEAGAVKFEFASTRT 317 + F LLRVTGI LPVWYEAGAVKFEFASTRT Sbjct: 113 ILFTDLLRVTGIRKLPVWYEAGAVKFEFASTRT 145