BLASTX nr result
ID: Akebia27_contig00024471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024471 (658 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004236590.1| PREDICTED: putative calcium-transporting ATP... 66 1e-08 gb|ADD91581.1| calcium ATPase [Nicotiana benthamiana] 65 2e-08 gb|ADD91580.1| calcium ATPase [Nicotiana benthamiana] 65 2e-08 gb|EMT19656.1| Putative calcium-transporting ATPase 6, plasma me... 64 3e-08 gb|EMS53093.1| putative calcium-transporting ATPase 6, plasma me... 64 3e-08 ref|XP_004166875.1| PREDICTED: LOW QUALITY PROTEIN: putative cal... 64 5e-08 ref|XP_004136665.1| PREDICTED: calcium-transporting ATPase 4, pl... 64 5e-08 ref|XP_003568195.1| PREDICTED: probable calcium-transporting ATP... 64 5e-08 ref|XP_006492951.1| PREDICTED: calcium-transporting ATPase 4, pl... 63 7e-08 ref|XP_004249737.1| PREDICTED: probable calcium-transporting ATP... 63 7e-08 ref|XP_002532129.1| cation-transporting atpase plant, putative [... 63 7e-08 ref|XP_006421285.1| hypothetical protein CICLE_v10004282mg [Citr... 63 9e-08 ref|XP_007028703.1| Autoinhibited Ca2+-ATPase 11 isoform 2 [Theo... 63 9e-08 ref|XP_007028702.1| Autoinhibited Ca2+-ATPase 11 isoform 1 [Theo... 63 9e-08 emb|CAC40030.1| P-type ATPase [Hordeum vulgare] 63 9e-08 ref|XP_004303642.1| PREDICTED: putative calcium-transporting ATP... 62 1e-07 gb|EYU42974.1| hypothetical protein MIMGU_mgv1a000650mg [Mimulus... 62 2e-07 ref|XP_006438912.1| hypothetical protein CICLE_v10030586mg [Citr... 62 2e-07 ref|XP_002308011.2| hypothetical protein POPTR_0006s04510g [Popu... 62 2e-07 ref|XP_004963679.1| PREDICTED: probable calcium-transporting ATP... 62 2e-07 >ref|XP_004236590.1| PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type-like [Solanum lycopersicum] Length = 1043 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSR+M+KIN+FRGIF SWIF+GVMV+TVV Sbjct: 943 QVFNEINSRDMEKINIFRGIFGSWIFIGVMVATVV 977 >gb|ADD91581.1| calcium ATPase [Nicotiana benthamiana] Length = 257 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSR+MDKIN+FRGIF SWIF+GVM +TVV Sbjct: 157 QVFNEINSRDMDKINIFRGIFSSWIFLGVMFATVV 191 >gb|ADD91580.1| calcium ATPase [Nicotiana benthamiana] Length = 1045 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSR+MDKIN+FRGIF SWIF+GVM +TVV Sbjct: 945 QVFNEINSRDMDKINIFRGIFSSWIFLGVMFATVV 979 >gb|EMT19656.1| Putative calcium-transporting ATPase 6, plasma membrane-type [Aegilops tauschii] Length = 964 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSREMDKINVFRGIF +WIFVG++ +TV+ Sbjct: 863 QVFNEINSREMDKINVFRGIFRNWIFVGILTATVI 897 >gb|EMS53093.1| putative calcium-transporting ATPase 6, plasma membrane-type [Triticum urartu] Length = 992 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSREMDKINVFRGIF +WIFVG++ +TV+ Sbjct: 891 QVFNEINSREMDKINVFRGIFRNWIFVGILTATVI 925 >ref|XP_004166875.1| PREDICTED: LOW QUALITY PROTEIN: putative calcium-transporting ATPase 11, plasma membrane-type-like, partial [Cucumis sativus] Length = 978 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSRE++KIN+FRG+F SWIF+GVMVSTV Sbjct: 876 QVFNEINSREIEKINIFRGMFSSWIFLGVMVSTV 909 >ref|XP_004136665.1| PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like [Cucumis sativus] Length = 1034 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSRE++KIN+FRG+F SWIF+GVMVSTV Sbjct: 932 QVFNEINSREIEKINIFRGMFSSWIFLGVMVSTV 965 >ref|XP_003568195.1| PREDICTED: probable calcium-transporting ATPase 6, plasma membrane-type-like [Brachypodium distachyon] Length = 1041 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSREMDKINVFRGIF +WIFVG++ +TV+ Sbjct: 940 QVFNEINSREMDKINVFRGIFRNWIFVGILSATVI 974 >ref|XP_006492951.1| PREDICTED: calcium-transporting ATPase 4, plasma membrane-type-like [Citrus sinensis] Length = 1036 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSREM+KINVF+G+FDSW+FVG++V TV Sbjct: 934 QVFNEINSREMEKINVFKGMFDSWLFVGILVLTV 967 >ref|XP_004249737.1| PREDICTED: probable calcium-transporting ATPase 5, plasma membrane-type-like [Solanum lycopersicum] Length = 868 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSR+++KINVFRGIF SWIFVGV+ STVV Sbjct: 769 QVFNEINSRDIEKINVFRGIFGSWIFVGVITSTVV 803 >ref|XP_002532129.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223528188|gb|EEF30249.1| cation-transporting atpase plant, putative [Ricinus communis] Length = 967 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 Q+FNEINSR+++KINVFRGIFDSW+F+ VMVSTV Sbjct: 867 QIFNEINSRQIEKINVFRGIFDSWVFLAVMVSTV 900 >ref|XP_006421285.1| hypothetical protein CICLE_v10004282mg [Citrus clementina] gi|557523158|gb|ESR34525.1| hypothetical protein CICLE_v10004282mg [Citrus clementina] Length = 875 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSREM+KINVF+G+FDSW+FVG++V TV Sbjct: 773 QVFNEINSREMEKINVFKGMFDSWMFVGILVLTV 806 >ref|XP_007028703.1| Autoinhibited Ca2+-ATPase 11 isoform 2 [Theobroma cacao] gi|508717308|gb|EOY09205.1| Autoinhibited Ca2+-ATPase 11 isoform 2 [Theobroma cacao] Length = 875 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSRE+ KIN+FRG+FDSWIF+ VMVST+ Sbjct: 773 QVFNEINSREIKKINIFRGMFDSWIFIAVMVSTI 806 >ref|XP_007028702.1| Autoinhibited Ca2+-ATPase 11 isoform 1 [Theobroma cacao] gi|508717307|gb|EOY09204.1| Autoinhibited Ca2+-ATPase 11 isoform 1 [Theobroma cacao] Length = 1036 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSRE+ KIN+FRG+FDSWIF+ VMVST+ Sbjct: 934 QVFNEINSREIKKINIFRGMFDSWIFIAVMVSTI 967 >emb|CAC40030.1| P-type ATPase [Hordeum vulgare] Length = 579 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSREM+KINVFRGIF +WIFVG++ +TV+ Sbjct: 478 QVFNEINSREMEKINVFRGIFRNWIFVGILTATVI 512 >ref|XP_004303642.1| PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type-like [Fragaria vesca subsp. vesca] Length = 1042 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSR+++KIN+FRG+FDSW+F+GVMV TV Sbjct: 941 QVFNEINSRDIEKINIFRGMFDSWVFLGVMVCTV 974 >gb|EYU42974.1| hypothetical protein MIMGU_mgv1a000650mg [Mimulus guttatus] Length = 1031 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSR+M++IN+FRGIF SWIFV VMVSTV Sbjct: 928 QVFNEINSRDMERINIFRGIFSSWIFVMVMVSTV 961 >ref|XP_006438912.1| hypothetical protein CICLE_v10030586mg [Citrus clementina] gi|568858848|ref|XP_006482955.1| PREDICTED: putative calcium-transporting ATPase 11, plasma membrane-type-like [Citrus sinensis] gi|557541108|gb|ESR52152.1| hypothetical protein CICLE_v10030586mg [Citrus clementina] Length = 1039 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTV 655 QVFNEINSR+M+KINVFRGIF SW+FV V+V+TV Sbjct: 935 QVFNEINSRDMEKINVFRGIFSSWVFVAVLVATV 968 >ref|XP_002308011.2| hypothetical protein POPTR_0006s04510g [Populus trichocarpa] gi|550335452|gb|EEE91534.2| hypothetical protein POPTR_0006s04510g [Populus trichocarpa] Length = 1018 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSR+++KINVFRG+F SWIF GVMV TVV Sbjct: 918 QVFNEINSRDIEKINVFRGMFSSWIFTGVMVITVV 952 >ref|XP_004963679.1| PREDICTED: probable calcium-transporting ATPase 6, plasma membrane-type-like [Setaria italica] Length = 1055 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +2 Query: 554 QVFNEINSREMDKINVFRGIFDSWIFVGVMVSTVV 658 QVFNEINSREM+KINVFRGIF +WIF+GV+ +TV+ Sbjct: 954 QVFNEINSREMEKINVFRGIFKNWIFIGVLSATVL 988