BLASTX nr result
ID: Akebia27_contig00024233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024233 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526013.1| nutrient reservoir, putative [Ricinus commun... 63 4e-08 ref|XP_003631207.1| PREDICTED: uncharacterized protein LOC100255... 59 9e-07 ref|XP_006469163.1| PREDICTED: zinc finger homeobox protein 4-li... 57 2e-06 gb|EXC04506.1| hypothetical protein L484_001671 [Morus notabilis] 56 5e-06 >ref|XP_002526013.1| nutrient reservoir, putative [Ricinus communis] gi|223534660|gb|EEF36353.1| nutrient reservoir, putative [Ricinus communis] Length = 137 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +1 Query: 1 PPPPPPFLYITGPPGNLYPFD-DYSGVDRVSDVGVLIRIGCWLIGFLV 141 PPPPP F+YITGPPGNLYP D DYS RV+ + VL IGC L G L+ Sbjct: 88 PPPPPSFIYITGPPGNLYPIDNDYSDAGRVTGLPVL--IGCGLFGLLL 133 >ref|XP_003631207.1| PREDICTED: uncharacterized protein LOC100255988 [Vitis vinifera] gi|147861978|emb|CAN80912.1| hypothetical protein VITISV_039820 [Vitis vinifera] Length = 136 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 3/50 (6%) Frame = +1 Query: 1 PPPPPP--FLYITGPPGNLYPFD-DYSGVDRVSDVGVLIRIGCWLIGFLV 141 PPPPPP FLY+TGPPG LYP D DY G R VG+ I GC L+ L+ Sbjct: 86 PPPPPPASFLYVTGPPGTLYPIDQDYGGAGRNFMVGLPILAGCGLLNLLL 135 >ref|XP_006469163.1| PREDICTED: zinc finger homeobox protein 4-like [Citrus sinensis] Length = 141 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = +1 Query: 1 PPPPPPFLYITGPPGNLYPFD-DYSGVDRVSDVGVLIRIGCWLIGFLVFWR 150 PPPPP F+YITGPPGNLYP D D++G + + + + ++G L W+ Sbjct: 91 PPPPPSFIYITGPPGNLYPVDSDFNGASKKIPSSLPLLVASGILGLLALWK 141 >gb|EXC04506.1| hypothetical protein L484_001671 [Morus notabilis] Length = 139 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +1 Query: 1 PPPPPPFLYITGPPGNLYPFDD---YSGVDRVSDVGVLIRIGCWLIGFLVFW 147 PPPP PF+YITGPPG LYP D Y+G + + + I + L+G FW Sbjct: 88 PPPPAPFIYITGPPGELYPVDKDFYYNGAAKSGPISLPILVASGLLGVFAFW 139