BLASTX nr result
ID: Akebia27_contig00024064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024064 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317554.2| hypothetical protein POPTR_0011s13340g [Popu... 55 8e-06 >ref|XP_002317554.2| hypothetical protein POPTR_0011s13340g [Populus trichocarpa] gi|550328305|gb|EEE98166.2| hypothetical protein POPTR_0011s13340g [Populus trichocarpa] Length = 719 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = +2 Query: 2 ETVKTMMPLLRYVEISHCQMLQSFPCEVNYVGVWKK 109 E V+ +MP +RYVE+SHC ML+SFPC ++ +GVW+K Sbjct: 684 EMVQRVMPRIRYVEVSHCYMLKSFPCNIDKLGVWRK 719