BLASTX nr result
ID: Akebia27_contig00024027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00024027 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266700.1| PREDICTED: protein kinase G11A-like [Vitis v... 61 2e-07 ref|XP_007208313.1| hypothetical protein PRUPE_ppa003043mg [Prun... 60 2e-07 ref|XP_002522785.1| serine/threonine protein kinase, putative [R... 60 4e-07 >ref|XP_002266700.1| PREDICTED: protein kinase G11A-like [Vitis vinifera] Length = 611 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -2 Query: 178 MASKAGSRAGSEQQKKVSNNQTVEANNRKPSPLQIPKTVVTAELVTPKKFPPPVQEVA 5 MASK+G+R ++QK+ +QT+E N+R+PSPLQI KT +E VTPKK P VQ VA Sbjct: 1 MASKSGARTSPDRQKRTFGSQTLEGNSRRPSPLQITKT-SKSEPVTPKKTPRSVQPVA 57 >ref|XP_007208313.1| hypothetical protein PRUPE_ppa003043mg [Prunus persica] gi|462403955|gb|EMJ09512.1| hypothetical protein PRUPE_ppa003043mg [Prunus persica] Length = 609 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/59 (54%), Positives = 41/59 (69%) Frame = -2 Query: 178 MASKAGSRAGSEQQKKVSNNQTVEANNRKPSPLQIPKTVVTAELVTPKKFPPPVQEVAA 2 MASK+G+R E Q+K+ +QT E N R+PSPLQI KT +E VTPKK P VQ+ A+ Sbjct: 3 MASKSGARTSPESQRKLIGSQTTEGNFRRPSPLQITKT-SKSEPVTPKKLPRHVQQTAS 60 >ref|XP_002522785.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223538023|gb|EEF39636.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 532 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 42/59 (71%) Frame = -2 Query: 178 MASKAGSRAGSEQQKKVSNNQTVEANNRKPSPLQIPKTVVTAELVTPKKFPPPVQEVAA 2 MASK +R E+ +K ++NQT E +R+PSPLQI KT +E VTPKK PP VQ++A+ Sbjct: 1 MASKPSTRTSPEKHRKGTSNQTPEGKSRRPSPLQITKT-SKSEPVTPKKPPPSVQQIAS 58