BLASTX nr result
ID: Akebia27_contig00023614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00023614 (1106 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826951.1| hypothetical protein AMTR_s00010p00188050 [A... 47 2e-08 ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi inter... 46 8e-08 gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Mimulus... 43 7e-06 >ref|XP_006826951.1| hypothetical protein AMTR_s00010p00188050 [Amborella trichopoda] gi|548831380|gb|ERM94188.1| hypothetical protein AMTR_s00010p00188050 [Amborella trichopoda] Length = 385 Score = 47.0 bits (110), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 967 MEILNKLRNLDTYPKINADFYSRTL 893 M++LNKLR+LD YPKIN DFYSRTL Sbjct: 1 MDVLNKLRHLDAYPKINEDFYSRTL 25 Score = 39.7 bits (91), Expect(2) = 2e-08 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = -1 Query: 812 IFYILIFDLQQFH*FVARLYVHVAAESKLTVDISREETLQVNCSKNTFKLYSCLLIS 642 IF +L+F + RLY+H A E+KL VD SR ETL++N TF C ++S Sbjct: 36 IFMLLLFFSE------LRLYLHAATETKLMVDTSRGETLRINFDV-TFPALPCSILS 85 >ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3 [Vitis vinifera] gi|302141938|emb|CBI19141.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 45.8 bits (107), Expect(2) = 8e-08 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -2 Query: 961 ILNKLRNLDTYPKINADFYSRTL 893 I+NKLRNLD YPKIN DFYSRTL Sbjct: 4 IINKLRNLDAYPKINEDFYSRTL 26 Score = 38.5 bits (88), Expect(2) = 8e-08 Identities = 23/57 (40%), Positives = 32/57 (56%) Frame = -1 Query: 812 IFYILIFDLQQFH*FVARLYVHVAAESKLTVDISREETLQVNCSKNTFKLYSCLLIS 642 IF +L+F + RLY+H E+KL VD SR ETL++N TF C ++S Sbjct: 37 IFMLLLFISE------LRLYLHAVTETKLVVDTSRGETLRINFDV-TFPALPCSILS 86 >gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Mimulus guttatus] Length = 386 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 964 EILNKLRNLDTYPKINADFYSRTL 893 ++ N+LRNLD YPKIN DFYSRTL Sbjct: 3 KMYNRLRNLDAYPKINEDFYSRTL 26 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 24/57 (42%), Positives = 31/57 (54%) Frame = -1 Query: 812 IFYILIFDLQQFH*FVARLYVHVAAESKLTVDISREETLQVNCSKNTFKLYSCLLIS 642 IF L+F L +F RLY+H +SKL VD SR L++N TF C L+S Sbjct: 37 IFIALLF-LSEF-----RLYLHTVTDSKLVVDTSRGGKLRINFDV-TFPSVPCTLLS 86