BLASTX nr result
ID: Akebia27_contig00023512
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00023512 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316964.1| hypothetical protein POPTR_0011s13470g [Popu... 56 5e-06 >ref|XP_002316964.1| hypothetical protein POPTR_0011s13470g [Populus trichocarpa] gi|222860029|gb|EEE97576.1| hypothetical protein POPTR_0011s13470g [Populus trichocarpa] Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 5/63 (7%) Frame = +3 Query: 9 RKRPSMRDIVQALCLIIKLTNTKKHHRLSFK---EKEATVEEDQSEIQIPIPE--LEREE 173 RKRPSMRDIVQ L I+KL + KKHH+ S E +++ DQ EI+ P+ E REE Sbjct: 361 RKRPSMRDIVQVLSRILKLRHNKKHHKKSLSATTADEVSIDMDQQEIRTPLSEHHHRREE 420 Query: 174 HID 182 +D Sbjct: 421 SVD 423