BLASTX nr result
ID: Akebia27_contig00023482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00023482 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC35272.1| hypothetical protein L484_026594 [Morus notabilis] 59 7e-07 >gb|EXC35272.1| hypothetical protein L484_026594 [Morus notabilis] Length = 451 Score = 58.9 bits (141), Expect = 7e-07 Identities = 43/109 (39%), Positives = 53/109 (48%) Frame = +3 Query: 12 NLDNKRIHRRHTYNAPAQAHXXXXXXXXXXXXXXXXEEIEMETPSGGXXXXXXXXXXXXX 191 N + R HRRH+YNAP+ AH EEIE ETP G Sbjct: 359 NKHSGRTHRRHSYNAPS-AHSDIKFDESDCDEED--EEIEAETPPNG------------- 402 Query: 192 XXSHGCQPNDRAGEDYSGSYRRNSLPCIHPKLPDYDALSARFEALKFRK 338 S QP RA +++S +HPKLPDYD+L+ARFEALK R+ Sbjct: 403 --STCFQPPQRAPPPVP--LKQDSPHSVHPKLPDYDSLAARFEALKHRR 447