BLASTX nr result
ID: Akebia27_contig00023440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00023440 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007217511.1| hypothetical protein PRUPE_ppa024929mg [Prun... 60 3e-07 gb|EXB74573.1| hypothetical protein L484_026270 [Morus notabilis] 56 6e-06 >ref|XP_007217511.1| hypothetical protein PRUPE_ppa024929mg [Prunus persica] gi|462413661|gb|EMJ18710.1| hypothetical protein PRUPE_ppa024929mg [Prunus persica] Length = 371 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 3 SMAFLYSPSAITQRFQGNKEKIISLRQQVILALFLTLIYNFLLCIYKKF 149 SMAFLYSP Q NKEK ISL +Q I+A+FLTL+Y FL+ Y+ F Sbjct: 323 SMAFLYSPPTFISNSQSNKEKTISLGEQAIMAIFLTLVYQFLVYFYRNF 371 >gb|EXB74573.1| hypothetical protein L484_026270 [Morus notabilis] Length = 381 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SMAFLYSPSAITQRFQGNK-EKIISLRQQVILALFLTLIYNFLLCIYKKF 149 SMAFLYSP +IT + + +K ISL QQVILA+ LTL+Y FL+ IY+KF Sbjct: 332 SMAFLYSPPSITSKPKPTTMDKTISLNQQVILAIALTLVYQFLVYIYQKF 381