BLASTX nr result
ID: Akebia27_contig00023183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00023183 (797 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046911.1| ARM repeat superfamily protein, putative iso... 88 4e-15 ref|XP_006383185.1| U-box domain-containing family protein [Popu... 86 2e-14 ref|XP_006380766.1| hypothetical protein POPTR_0007s13010g [Popu... 84 5e-14 ref|XP_002310241.2| hypothetical protein POPTR_0007s13010g [Popu... 84 5e-14 gb|EXB59099.1| U-box domain-containing protein 5 [Morus notabilis] 83 1e-13 emb|CAN75512.1| hypothetical protein VITISV_020770 [Vitis vinifera] 80 7e-13 ref|XP_006425659.1| hypothetical protein CICLE_v10024987mg [Citr... 80 9e-13 ref|XP_004289139.1| PREDICTED: U-box domain-containing protein 5... 80 1e-12 ref|XP_002281339.1| PREDICTED: U-box domain-containing protein 5... 79 1e-12 emb|CBI17504.3| unnamed protein product [Vitis vinifera] 79 2e-12 ref|XP_002521570.1| ubiquitin-protein ligase, putative [Ricinus ... 77 1e-11 ref|XP_002306872.1| hypothetical protein POPTR_0005s24970g [Popu... 76 1e-11 dbj|BAB55653.1| bg55 [Bruguiera gymnorhiza] 76 2e-11 ref|XP_003612032.1| U-box domain-containing protein [Medicago tr... 75 3e-11 ref|XP_002266200.2| PREDICTED: U-box domain-containing protein 5... 74 8e-11 ref|XP_006845220.1| hypothetical protein AMTR_s00005p00254320 [A... 73 1e-10 ref|XP_002510402.1| Spotted leaf protein, putative [Ricinus comm... 73 1e-10 ref|XP_004512054.1| PREDICTED: U-box domain-containing protein 5... 72 3e-10 ref|XP_006366992.1| PREDICTED: U-box domain-containing protein 5... 71 4e-10 ref|XP_006340633.1| PREDICTED: U-box domain-containing protein 5... 71 5e-10 >ref|XP_007046911.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590703577|ref|XP_007046912.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590703580|ref|XP_007046913.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590703583|ref|XP_007046914.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|590703586|ref|XP_007046915.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699172|gb|EOX91068.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699173|gb|EOX91069.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699174|gb|EOX91070.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508699175|gb|EOX91071.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699176|gb|EOX91072.1| ARM repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 757 Score = 87.8 bits (216), Expect = 4e-15 Identities = 43/67 (64%), Positives = 53/67 (79%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DAAEV E S K+H +MCTEL KFVDRI +IFP IE+ARPRC+SG+++LCSLN Sbjct: 1 MGTDAAEVVETPTIPSFFKVHHMMCTELGKFVDRIVRIFPEIEAARPRCDSGIKALCSLN 60 Query: 776 LAMEKAK 796 A+ KAK Sbjct: 61 NAIVKAK 67 >ref|XP_006383185.1| U-box domain-containing family protein [Populus trichocarpa] gi|550338767|gb|ERP60982.1| U-box domain-containing family protein [Populus trichocarpa] Length = 760 Score = 85.5 bits (210), Expect = 2e-14 Identities = 39/67 (58%), Positives = 52/67 (77%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DAAEV E L + K+H MCTELMK VD++S+ F IE+ARPRC+SG+++LC LN Sbjct: 1 MGTDAAEVVETLPFPYSFKVHHSMCTELMKLVDKVSKTFLEIEAARPRCSSGIQALCLLN 60 Query: 776 LAMEKAK 796 A+EKA+ Sbjct: 61 KALEKAR 67 >ref|XP_006380766.1| hypothetical protein POPTR_0007s13010g [Populus trichocarpa] gi|550334768|gb|ERP58563.1| hypothetical protein POPTR_0007s13010g [Populus trichocarpa] Length = 772 Score = 84.3 bits (207), Expect = 5e-14 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DAAE E L K+H MCTEL+K VD++S+IFP IE+ARP C+ G+++LCSLN Sbjct: 1 MGTDAAEAVETLPCPYSFKVHHSMCTELLKLVDKVSKIFPKIEAARPCCSLGIQALCSLN 60 Query: 776 LAMEKAK 796 A+EKAK Sbjct: 61 NALEKAK 67 >ref|XP_002310241.2| hypothetical protein POPTR_0007s13010g [Populus trichocarpa] gi|550334767|gb|EEE90691.2| hypothetical protein POPTR_0007s13010g [Populus trichocarpa] Length = 747 Score = 84.3 bits (207), Expect = 5e-14 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DAAE E L K+H MCTEL+K VD++S+IFP IE+ARP C+ G+++LCSLN Sbjct: 1 MGTDAAEAVETLPCPYSFKVHHSMCTELLKLVDKVSKIFPKIEAARPCCSLGIQALCSLN 60 Query: 776 LAMEKAK 796 A+EKAK Sbjct: 61 NALEKAK 67 >gb|EXB59099.1| U-box domain-containing protein 5 [Morus notabilis] Length = 754 Score = 83.2 bits (204), Expect = 1e-13 Identities = 39/66 (59%), Positives = 50/66 (75%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+D AE E K+H L+CTELMK VDRIS+IFP IE+ARPRC++G+++LC LN Sbjct: 1 MGTDVAEALERATNVRSFKVHRLICTELMKLVDRISRIFPKIEAARPRCSTGIQALCMLN 60 Query: 776 LAMEKA 793 A+EKA Sbjct: 61 KAIEKA 66 >emb|CAN75512.1| hypothetical protein VITISV_020770 [Vitis vinifera] Length = 812 Score = 80.5 bits (197), Expect = 7e-13 Identities = 42/73 (57%), Positives = 53/73 (72%) Frame = +2 Query: 578 RTLCYWMGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLE 757 R L MGSD A V L Y IK+H L+C +L ++DRISQIF AIESARPRC +G++ Sbjct: 5 RILSNLMGSDTAVVE--LPYYCTIKVHRLICLKLKSYIDRISQIFSAIESARPRCGTGMQ 62 Query: 758 SLCSLNLAMEKAK 796 +LCSL+ AM+KAK Sbjct: 63 ALCSLHHAMDKAK 75 >ref|XP_006425659.1| hypothetical protein CICLE_v10024987mg [Citrus clementina] gi|568824857|ref|XP_006466808.1| PREDICTED: U-box domain-containing protein 5-like isoform X1 [Citrus sinensis] gi|568824859|ref|XP_006466809.1| PREDICTED: U-box domain-containing protein 5-like isoform X2 [Citrus sinensis] gi|557527649|gb|ESR38899.1| hypothetical protein CICLE_v10024987mg [Citrus clementina] Length = 737 Score = 80.1 bits (196), Expect = 9e-13 Identities = 35/67 (52%), Positives = 52/67 (77%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+D +E+ E+ + K+H MCT+L KFV+RI+++FP IE+ARPRC+SG+++LC LN Sbjct: 1 MGTDESEIVEIWSSPTSFKVHHGMCTQLSKFVERIAKVFPEIEAARPRCSSGVQALCLLN 60 Query: 776 LAMEKAK 796 A+ KAK Sbjct: 61 NAIGKAK 67 >ref|XP_004289139.1| PREDICTED: U-box domain-containing protein 5-like [Fragaria vesca subsp. vesca] Length = 769 Score = 79.7 bits (195), Expect = 1e-12 Identities = 36/67 (53%), Positives = 51/67 (76%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG++AAE E ++ K+H MC EL K V+RIS+IFP IE+ARPRC++G+++LC LN Sbjct: 1 MGTNAAEEVETVRKPCSFKVHHSMCIELWKLVERISEIFPDIEAARPRCSTGIQALCMLN 60 Query: 776 LAMEKAK 796 A++KAK Sbjct: 61 CAIQKAK 67 >ref|XP_002281339.1| PREDICTED: U-box domain-containing protein 5-like [Vitis vinifera] Length = 766 Score = 79.3 bits (194), Expect = 1e-12 Identities = 40/67 (59%), Positives = 51/67 (76%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MGSD A V L Y IK+H L+C +L ++DRISQIF AIESARPRC +G+++LCSL+ Sbjct: 1 MGSDTAVVE--LPYYCTIKVHRLICLKLKSYIDRISQIFSAIESARPRCGTGMQALCSLH 58 Query: 776 LAMEKAK 796 AM+KAK Sbjct: 59 HAMDKAK 65 >emb|CBI17504.3| unnamed protein product [Vitis vinifera] Length = 761 Score = 79.0 bits (193), Expect = 2e-12 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DA EV L + +K+H LMCT+LM VDR+ +I P IE+ARP C +G ++LCS+N Sbjct: 1 MGTDATEVVPTLPRPNAVKVHQLMCTDLMNLVDRVLKILPEIEAARP-CKAGRDALCSIN 59 Query: 776 LAMEKAK 796 LA+EKAK Sbjct: 60 LAIEKAK 66 >ref|XP_002521570.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539248|gb|EEF40841.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 748 Score = 76.6 bits (187), Expect = 1e-11 Identities = 37/67 (55%), Positives = 48/67 (71%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DA E L Y K+H MC ELMK VDRI ++FP +E+ARPRC+SG++SLC LN Sbjct: 1 MGTDAVET---LPYYYTFKVHHSMCMELMKLVDRIEKVFPEVEAARPRCSSGIQSLCLLN 57 Query: 776 LAMEKAK 796 +EKA+ Sbjct: 58 GTIEKAR 64 >ref|XP_002306872.1| hypothetical protein POPTR_0005s24970g [Populus trichocarpa] gi|566173107|ref|XP_006383709.1| hypothetical protein POPTR_0005s24970g [Populus trichocarpa] gi|222856321|gb|EEE93868.1| hypothetical protein POPTR_0005s24970g [Populus trichocarpa] gi|550339691|gb|ERP61506.1| hypothetical protein POPTR_0005s24970g [Populus trichocarpa] Length = 735 Score = 76.3 bits (186), Expect = 1e-11 Identities = 39/67 (58%), Positives = 50/67 (74%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG D A+ E+ S +K+H MC EL FVDRISQI+PAIESARPRC+SG+++LCSL Sbjct: 1 MGKDRAKDVELPSCFS-VKVHRSMCLELKNFVDRISQIYPAIESARPRCSSGVQALCSLV 59 Query: 776 LAMEKAK 796 + M+ AK Sbjct: 60 VNMDTAK 66 >dbj|BAB55653.1| bg55 [Bruguiera gymnorhiza] Length = 756 Score = 75.9 bits (185), Expect = 2e-11 Identities = 35/67 (52%), Positives = 47/67 (70%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MG+DA EV E L + K+H +C EL K VDRI ++FP IE++RPRC G+E LC LN Sbjct: 1 MGTDAGEVVETLPHCYSCKVHQSICRELRKVVDRIERLFPNIEASRPRCRLGIEVLCLLN 60 Query: 776 LAMEKAK 796 A+++AK Sbjct: 61 DALDRAK 67 >ref|XP_003612032.1| U-box domain-containing protein [Medicago truncatula] gi|355513367|gb|AES94990.1| U-box domain-containing protein [Medicago truncatula] Length = 767 Score = 75.1 bits (183), Expect = 3e-11 Identities = 35/67 (52%), Positives = 48/67 (71%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 M +++ E+ E + ++HS +C ELMK VD I +IFP IE ARPRC+SG+ESLC LN Sbjct: 1 MRTNSGEIVETFPNTLSFQVHSKICIELMKIVDSIMRIFPDIEEARPRCSSGIESLCFLN 60 Query: 776 LAMEKAK 796 ++EKAK Sbjct: 61 NSIEKAK 67 >ref|XP_002266200.2| PREDICTED: U-box domain-containing protein 5 [Vitis vinifera] Length = 902 Score = 73.6 bits (179), Expect = 8e-11 Identities = 38/85 (44%), Positives = 52/85 (61%), Gaps = 16/85 (18%) Frame = +2 Query: 590 YWMGSDAAEVAEVLQYSSGIK----------------MHSLMCTELMKFVDRISQIFPAI 721 +WMG+DA EV L + +K +H LMCT+LM VDR+ +I P I Sbjct: 124 HWMGTDATEVVPTLPRPNAVKAYFKWHMVVWGCGRFKVHQLMCTDLMNLVDRVLKILPEI 183 Query: 722 ESARPRCNSGLESLCSLNLAMEKAK 796 E+ARP C +G ++LCS+NLA+EKAK Sbjct: 184 EAARP-CKAGRDALCSINLAIEKAK 207 >ref|XP_006845220.1| hypothetical protein AMTR_s00005p00254320 [Amborella trichopoda] gi|548847733|gb|ERN06895.1| hypothetical protein AMTR_s00005p00254320 [Amborella trichopoda] Length = 803 Score = 73.2 bits (178), Expect = 1e-10 Identities = 34/64 (53%), Positives = 48/64 (75%) Frame = +2 Query: 605 DAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLNLAM 784 D AEV E L S K+H MC +L +FV ++ IFPA+E++RPRC SGL++LCSL++A+ Sbjct: 3 DTAEVEESLFAVSDAKLHGEMCKKLSEFVCKVMAIFPALEASRPRCKSGLQALCSLHVAL 62 Query: 785 EKAK 796 EK+K Sbjct: 63 EKSK 66 >ref|XP_002510402.1| Spotted leaf protein, putative [Ricinus communis] gi|223551103|gb|EEF52589.1| Spotted leaf protein, putative [Ricinus communis] Length = 525 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = +2 Query: 647 IKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLNLAMEKAK 796 +K+H LMC EL F+DRIS+IF IESARPRC +GL++LCSL+ AM+KAK Sbjct: 1 MKVHRLMCLELKNFIDRISRIFSEIESARPRCATGLQALCSLHAAMDKAK 50 >ref|XP_004512054.1| PREDICTED: U-box domain-containing protein 5-like [Cicer arietinum] Length = 762 Score = 71.6 bits (174), Expect = 3e-10 Identities = 35/67 (52%), Positives = 48/67 (71%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 M + E E+L S ++HS +CTEL+K VD I +I P IE+ARP+C+SG+ESLC LN Sbjct: 1 MRTVTGEEVEMLPNSRLFQVHSKICTELLKLVDSIMRILPEIEAARPKCSSGIESLCFLN 60 Query: 776 LAMEKAK 796 ++EKAK Sbjct: 61 NSIEKAK 67 >ref|XP_006366992.1| PREDICTED: U-box domain-containing protein 5-like [Solanum tuberosum] Length = 735 Score = 71.2 bits (173), Expect = 4e-10 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 M SD+AE +E IK+H LM EL +F+ R+S + PAIE+ARP C+SG E+LC LN Sbjct: 1 MWSDSAEASETPSSYRAIKVHHLMYMELFQFITRVSVLLPAIEAARPGCSSGREALCRLN 60 Query: 776 LAMEKAK 796 + ++KAK Sbjct: 61 IEIDKAK 67 >ref|XP_006340633.1| PREDICTED: U-box domain-containing protein 5-like isoform X1 [Solanum tuberosum] gi|565347226|ref|XP_006340634.1| PREDICTED: U-box domain-containing protein 5-like isoform X2 [Solanum tuberosum] Length = 736 Score = 70.9 bits (172), Expect = 5e-10 Identities = 36/67 (53%), Positives = 46/67 (68%) Frame = +2 Query: 596 MGSDAAEVAEVLQYSSGIKMHSLMCTELMKFVDRISQIFPAIESARPRCNSGLESLCSLN 775 MGSDAA VA + IK+H LMC EL+KFV R++ + PAIE ARP N G++ LC L Sbjct: 1 MGSDAASVAGIPS-PRDIKVHRLMCMELIKFVTRVAMLLPAIEEARPGSNPGIQVLCQLT 59 Query: 776 LAMEKAK 796 A++KAK Sbjct: 60 RALDKAK 66