BLASTX nr result
ID: Akebia27_contig00023048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00023048 (1532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium h... 70 2e-09 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 70 2e-09 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 70 2e-09 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 70 2e-09 gb|AAL48209.1|AF387188_1 ribosomal protein L2 [Ulmus thomasii] 70 2e-09 gb|AAL48208.1|AF387187_1 ribosomal protein L2 [Gossypium arboreum] 70 2e-09 gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palm... 70 3e-09 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 69 6e-09 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] 69 7e-09 ref|XP_004253315.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 69 7e-09 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 69 7e-09 gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tubero... 69 7e-09 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 68 1e-08 pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 68 1e-08 ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 68 1e-08 ref|XP_006401951.1| hypothetical protein EUTSA_v10013769mg [Eutr... 67 2e-08 gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sa... 67 2e-08 ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|375911... 67 2e-08 ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochond... 67 2e-08 ref|YP_004927575.1| rpl2 (mitochondrion) [Brassica carinata] gi|... 67 2e-08 >gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 215 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFRR 251 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 216 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFRR 252 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 216 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFRR 252 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 216 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFRR 252 >gb|AAL48209.1|AF387188_1 ribosomal protein L2 [Ulmus thomasii] Length = 246 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 188 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFRR 224 >gb|AAL48208.1|AF387187_1 ribosomal protein L2 [Gossypium arboreum] Length = 270 Score = 70.5 bits (171), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 201 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWQSFRR 237 >gb|AAL48207.1|AF387186_1 ribosomal protein L2 [Lonicera sp. Palmer 679] Length = 228 Score = 70.1 bits (170), Expect = 3e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCE+RKWR SILWAHRIK K LSWQSFRR Sbjct: 158 GKNTFSLCEIRKWRTHSILWAHRIKRKAALSWQSFRR 194 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 68.9 bits (167), Expect = 6e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSW+SFRR Sbjct: 213 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWRSFRR 249 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] Length = 331 Score = 68.6 bits (166), Expect = 7e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCE+RKWR SILW HRIK K LSWQSFRR Sbjct: 212 GKNTFSLCEIRKWRTHSILWVHRIKRKAALSWQSFRR 248 >ref|XP_004253315.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like, partial [Solanum lycopersicum] Length = 366 Score = 68.6 bits (166), Expect = 7e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCE+RKWR SILW HRIK K LSWQSFRR Sbjct: 202 GKNTFSLCEIRKWRTHSILWVHRIKRKAALSWQSFRR 238 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 68.6 bits (166), Expect = 7e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCE+RKWR SILW HRIK K LSWQSFRR Sbjct: 212 GKNTFSLCEIRKWRTHSILWVHRIKRKAALSWQSFRR 248 >gb|AAD03036.1| ribosomal protein large subunit 2 [Solanum tuberosum] Length = 296 Score = 68.6 bits (166), Expect = 7e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCE+RKWR SILW HRIK K LSWQSFRR Sbjct: 214 GKNTFSLCEIRKWRTHSILWVHRIKRKAALSWQSFRR 250 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTF LCE+RKWR SILWAHRIK K LSWQSFRR Sbjct: 216 GKNTFFLCEIRKWRTHSILWAHRIKRKAALSWQSFRR 252 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 67.8 bits (164), Expect = 1e-08 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHRIK K LSW SFRR Sbjct: 213 GKNTFSLCEVRKWRTHSILWAHRIKRKAALSWLSFRR 249 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 67.8 bits (164), Expect = 1e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GKNTFSLCEVRKWR SILWAHR+K K L WQSFRR Sbjct: 213 GKNTFSLCEVRKWRTHSILWAHRMKRKAALDWQSFRR 249 >ref|XP_006401951.1| hypothetical protein EUTSA_v10013769mg [Eutrema salsugineum] gi|557103041|gb|ESQ43404.1| hypothetical protein EUTSA_v10013769mg [Eutrema salsugineum] Length = 389 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GK+TFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 214 GKSTFSLCEVRKWRTHSILWAHRIKGKVGLSWQSFRR 250 >gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GK+TFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 214 GKSTFSLCEVRKWRTHSILWAHRIKGKAGLSWQSFRR 250 >ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|37591104|dbj|BAC98906.1| ribosomal protein L2 [Brassica napus] Length = 349 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GK+TFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 214 GKSTFSLCEVRKWRTHSILWAHRIKGKAGLSWQSFRR 250 >ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278283|dbj|BAM36207.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278329|dbj|BAM36252.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|443298136|gb|AGC81680.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GK+TFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 214 GKSTFSLCEVRKWRTHSILWAHRIKGKAGLSWQSFRR 250 >ref|YP_004927575.1| rpl2 (mitochondrion) [Brassica carinata] gi|335355036|gb|AEH43590.1| rpl2 [Brassica carinata] Length = 349 Score = 67.4 bits (163), Expect = 2e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +2 Query: 908 GKNTFSLCEVRKWRMLSILWAHRIKCKTVLSWQSFRR 1018 GK+TFSLCEVRKWR SILWAHRIK K LSWQSFRR Sbjct: 214 GKSTFSLCEVRKWRTHSILWAHRIKGKAGLSWQSFRR 250