BLASTX nr result
ID: Akebia27_contig00022616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00022616 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 56 6e-06 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/101 (31%), Positives = 51/101 (50%), Gaps = 1/101 (0%) Frame = +3 Query: 6 GF*FSMTKLLTWNVHGLGERKKRTAVQAVIRASSTNLTVIQELKLSASNEPLVKELWGW* 185 G S+ K+++WN+ GLG R+KR V+ +R ++ ++ E K + LV +WG Sbjct: 317 GLFLSLMKIISWNIRGLGSRRKRLLVKEQLRRLKPDIVILLETKKEIVDRQLVAGVWGSR 376 Query: 186 HR-MVMSAGNRCFWRNYSMWTKDKIRVKDSLVGAISVSLRI 305 + V S +W + V DS+VG SVS+RI Sbjct: 377 FKEWVFSPSLGRSGGIAVLWNSQSVSVIDSMVGEFSVSIRI 417