BLASTX nr result
ID: Akebia27_contig00021858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00021858 (644 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 68 3e-09 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 67 4e-09 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 67 5e-09 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 67 6e-09 ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phas... 66 8e-09 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 66 8e-09 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 66 8e-09 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 65 2e-08 gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus... 64 5e-08 ref|NP_564545.1| translocase of the outer mitochondrial membrane... 64 5e-08 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 63 9e-08 ref|XP_004492183.1| PREDICTED: mitochondrial import receptor sub... 62 2e-07 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 62 2e-07 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK232... 61 3e-07 ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arab... 61 3e-07 ref|XP_006592291.1| PREDICTED: mitochondrial import receptor sub... 60 7e-07 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 60 7e-07 ref|XP_006393259.1| hypothetical protein EUTSA_v10011932mg [Eutr... 59 1e-06 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KAEALKQ+R+HV MFG W+VV+RVTPY+L+Y+ Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYI 43 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KAEALKQ+++HV MFG W+VV+RVTPY+L+YL Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYL 43 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ+R+HV MFGVW+ V+RVTPY+L+YL Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYL 43 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ+RTHV MFG W+ V+RVTPYIL+Y+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHYI 43 >ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] gi|561004882|gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/43 (62%), Positives = 38/43 (88%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ+++HVTMFG W+VV+RVTPY+L++L Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPYVLHFL 43 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ++ HV MFGVW+ VVRVTPYIL+YL Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYL 43 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 66.2 bits (160), Expect = 8e-09 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYLC 409 MF G F ++P+KA ALKQ+++H MFG W+VV+RVTPY+L++LC Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLC 44 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNY 415 MF G F ++P+KA ALKQ+R+HV MFG W+VV+RVTPY+L+Y Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHY 42 >gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus guttatus] Length = 122 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -3 Query: 546 REMFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 ++MF G F ++P+KA ALKQ+R+H MFG W+ V+RV PYIL+YL Sbjct: 67 KKMFPGMFMRKPDKAAALKQLRSHAAMFGAWVAVIRVAPYILHYL 111 >ref|NP_564545.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] gi|46577137|sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gi|5430759|gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gi|11692924|gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gi|11762280|gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gi|11935199|gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gi|12642920|gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gi|14335020|gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|27363338|gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|332194306|gb|AEE32427.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] Length = 54 Score = 63.5 bits (153), Expect = 5e-08 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNY 415 MF G F ++P+KAEALKQ+RTHV +FG W+V++R PY+L+Y Sbjct: 1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPYVLSY 42 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ+++H MFG W+VV+RVTPY+L++L Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLHFL 43 >ref|XP_004492183.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cicer arietinum] Length = 54 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNY 415 MF G F ++P+KA ALKQ+++HV MFG W+VV+RV PYIL Y Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGTWVVVIRVAPYILYY 42 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNY 415 MF G F ++P+KA ALKQ++THV +FG W+ V+RV PYIL+Y Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHY 42 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 61.6 bits (148), Expect = 2e-07 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ++TH +FG W+ ++RVTPY+L+YL Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYL 43 >gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK23244.1| unknown [Picea sitchensis] gi|116789568|gb|ABK25295.1| unknown [Picea sitchensis] Length = 55 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/43 (53%), Positives = 34/43 (79%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MFLGA P+RP+KA A KQ+R H+T+ G+W+ +RV PY+ ++L Sbjct: 1 MFLGAIPRRPDKAAAYKQLRKHLTLLGIWVAAIRVAPYVAHFL 43 >ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] gi|297340022|gb|EFH70439.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNY 415 MF G F ++P+KA ALKQ+RTHV +FG W+V+VR PY+L+Y Sbjct: 1 MFPGMFMRKPDKAVALKQLRTHVALFGGWVVIVRAVPYVLSY 42 >ref|XP_006592291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 83 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/43 (55%), Positives = 36/43 (83%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 MF G F ++P+KA ALKQ+++HV MF W+VV++VTPY+L++L Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVVMFQAWVVVIQVTPYVLHFL 43 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = -3 Query: 543 EMFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNYL 412 +MF G F ++P+KA ALKQ+++H MFG W+ VVR PY+L+YL Sbjct: 1 KMFPGMFMRKPDKAAALKQLKSHAIMFGAWIAVVRAAPYVLHYL 44 >ref|XP_006393259.1| hypothetical protein EUTSA_v10011932mg [Eutrema salsugineum] gi|557089837|gb|ESQ30545.1| hypothetical protein EUTSA_v10011932mg [Eutrema salsugineum] Length = 54 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -3 Query: 540 MFLGAFPQRPEKAEALKQMRTHVTMFGVWMVVVRVTPYILNY 415 MF G F Q+P+KA ALKQ+RTH +FG W+VV+R PY+ +Y Sbjct: 1 MFPGMFMQKPDKAVALKQLRTHAALFGGWVVVIRAVPYVFSY 42