BLASTX nr result
ID: Akebia27_contig00021796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00021796 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33207.1| Two-component response regulator-like protein [Mo... 98 1e-18 dbj|BAE72697.1| pseudo-response regulator 37 homologue [Lemna pa... 98 1e-18 dbj|BAE72700.1| pseudo-response regulator 37 homologue [Lemna gi... 98 1e-18 gb|AFW88754.1| hypothetical protein ZEAMMB73_978741 [Zea mays] 98 1e-18 emb|CBI16234.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_002281776.1| PREDICTED: two-component response regulator-... 98 1e-18 ref|XP_002531836.1| sensory transduction histidine kinase, putat... 98 1e-18 gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus... 97 2e-18 gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus... 97 2e-18 ref|XP_006594103.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_006588746.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_006588745.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_007027197.1| Sensory transduction histidine kinase, putat... 97 2e-18 ref|XP_004169415.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_004142221.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_006594104.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_003536977.1| PREDICTED: two-component response regulator-... 97 2e-18 ref|XP_002525199.1| sensory transduction histidine kinase, putat... 97 2e-18 ref|XP_006592246.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 97 3e-18 ref|XP_006591007.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 97 3e-18 >gb|EXC33207.1| Two-component response regulator-like protein [Morus notabilis] Length = 755 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 152 MMSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 198 >dbj|BAE72697.1| pseudo-response regulator 37 homologue [Lemna paucicostata] Length = 617 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 157 MMSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 203 >dbj|BAE72700.1| pseudo-response regulator 37 homologue [Lemna gibba] Length = 623 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 157 MMSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 203 >gb|AFW88754.1| hypothetical protein ZEAMMB73_978741 [Zea mays] Length = 743 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVSC*FFS 265 +MS++D+M +VFKCLSKGAVDFLVKP+RKNELKNLWQHVWRRCHSVSC F S Sbjct: 163 MMSTNDSMSMVFKCLSKGAVDFLVKPLRKNELKNLWQHVWRRCHSVSCLFLS 214 >emb|CBI16234.3| unnamed protein product [Vitis vinifera] Length = 482 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 175 MMSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 221 >ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera] Length = 785 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 175 MMSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 221 >ref|XP_002531836.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223528532|gb|EEF30556.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 807 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 154 MMSSHDSMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 200 >gb|EYU41647.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus guttatus] Length = 658 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 146 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 192 >gb|EYU41646.1| hypothetical protein MIMGU_mgv1a002467mg [Mimulus guttatus] Length = 670 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 146 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 192 >ref|XP_006594103.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 755 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 167 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 213 >ref|XP_006588746.1| PREDICTED: two-component response regulator-like APRR7-like isoform X3 [Glycine max] Length = 749 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 165 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 211 >ref|XP_006588745.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 753 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 165 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 211 >ref|XP_007027197.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|590630175|ref|XP_007027198.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|590630179|ref|XP_007027199.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715802|gb|EOY07699.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715803|gb|EOY07700.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715804|gb|EOY07701.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] Length = 783 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 168 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 214 >ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 794 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 169 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 215 >ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 797 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 169 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 215 >ref|XP_006594104.1| PREDICTED: two-component response regulator-like APRR7-like isoform X2 [Glycine max] Length = 749 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 161 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 207 >ref|XP_003536977.1| PREDICTED: two-component response regulator-like APRR7-like isoform X1 [Glycine max] Length = 747 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 159 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 205 >ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Length = 762 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MG+VFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS S Sbjct: 168 MMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 214 >ref|XP_006592246.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator-like PRR37-like [Glycine max] Length = 786 Score = 97.1 bits (240), Expect = 3e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIR+NELKNLWQHVWRRCHS S Sbjct: 167 MMSSHDSMGIVFKCLSKGAVDFLVKPIRRNELKNLWQHVWRRCHSSS 213 >ref|XP_006591007.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator-like PRR73-like [Glycine max] Length = 833 Score = 97.1 bits (240), Expect = 3e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 420 VMSSHDAMGIVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSVS 280 +MSSHD+MGIVFKCLSKGAVDFLVKPIR+NELKNLWQHVWRRCHS S Sbjct: 167 MMSSHDSMGIVFKCLSKGAVDFLVKPIRRNELKNLWQHVWRRCHSSS 213