BLASTX nr result
ID: Akebia27_contig00021056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00021056 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28434.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002269146.1| PREDICTED: uncharacterized protein LOC100261... 60 4e-07 ref|XP_002521188.1| RNA binding protein, putative [Ricinus commu... 60 4e-07 gb|EXC45494.1| RNA-binding protein EWS [Morus notabilis] 59 9e-07 ref|XP_006488581.1| PREDICTED: transcription initiation factor T... 57 2e-06 ref|XP_006350862.1| PREDICTED: transcription initiation factor T... 57 2e-06 ref|XP_006350861.1| PREDICTED: transcription initiation factor T... 57 2e-06 ref|XP_006425144.1| hypothetical protein CICLE_v10027796mg [Citr... 57 2e-06 ref|XP_007016971.1| TBP-associated factor 15B isoform 2 [Theobro... 57 3e-06 ref|XP_007016970.1| TBP-associated factor 15B isoform 1 [Theobro... 57 3e-06 ref|XP_004145234.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 57 3e-06 ref|XP_007015000.1| Uncharacterized protein TCM_040624 [Theobrom... 57 3e-06 ref|XP_006641014.1| PREDICTED: TATA-binding protein-associated f... 56 5e-06 ref|XP_006401076.1| hypothetical protein EUTSA_v10012621mg [Eutr... 56 5e-06 ref|XP_006281876.1| hypothetical protein CARUB_v10028073mg, part... 56 5e-06 dbj|BAB10262.1| unnamed protein product [Arabidopsis thaliana] 56 5e-06 ref|XP_002866269.1| hypothetical protein ARALYDRAFT_495966 [Arab... 56 5e-06 gb|AAR28021.1| TAF15b [Arabidopsis thaliana] 56 5e-06 ref|NP_851215.1| TBP-associated factor 15B [Arabidopsis thaliana... 56 5e-06 ref|XP_006596908.1| PREDICTED: transcription initiation factor T... 56 6e-06 >emb|CBI28434.3| unnamed protein product [Vitis vinifera] Length = 873 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DWLCPNPSCGNLNFARRVECNKC Sbjct: 621 DWLCPNPSCGNLNFARRVECNKC 643 >ref|XP_002269146.1| PREDICTED: uncharacterized protein LOC100261263 [Vitis vinifera] Length = 462 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DWLCPNPSCGNLNFARRVECNKC Sbjct: 99 DWLCPNPSCGNLNFARRVECNKC 121 >ref|XP_002521188.1| RNA binding protein, putative [Ricinus communis] gi|223539602|gb|EEF41188.1| RNA binding protein, putative [Ricinus communis] Length = 437 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DWLCPNPSCGNLNFARRVECNKC Sbjct: 99 DWLCPNPSCGNLNFARRVECNKC 121 >gb|EXC45494.1| RNA-binding protein EWS [Morus notabilis] Length = 588 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW+CPNPSCGNLNFARRVECNKC Sbjct: 92 DWVCPNPSCGNLNFARRVECNKC 114 >ref|XP_006488581.1| PREDICTED: transcription initiation factor TFIID subunit 15b-like [Citrus sinensis] Length = 439 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARRVECNKC Sbjct: 88 DWKCPNPSCGNLNFARRVECNKC 110 >ref|XP_006350862.1| PREDICTED: transcription initiation factor TFIID subunit 15b-like isoform X2 [Solanum tuberosum] gi|565368460|ref|XP_006350863.1| PREDICTED: transcription initiation factor TFIID subunit 15b-like isoform X3 [Solanum tuberosum] Length = 450 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARRVECNKC Sbjct: 111 DWRCPNPSCGNLNFARRVECNKC 133 >ref|XP_006350861.1| PREDICTED: transcription initiation factor TFIID subunit 15b-like isoform X1 [Solanum tuberosum] Length = 461 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARRVECNKC Sbjct: 122 DWRCPNPSCGNLNFARRVECNKC 144 >ref|XP_006425144.1| hypothetical protein CICLE_v10027796mg [Citrus clementina] gi|557527078|gb|ESR38384.1| hypothetical protein CICLE_v10027796mg [Citrus clementina] Length = 863 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARRVECNKC Sbjct: 566 DWKCPNPSCGNLNFARRVECNKC 588 >ref|XP_007016971.1| TBP-associated factor 15B isoform 2 [Theobroma cacao] gi|508787334|gb|EOY34590.1| TBP-associated factor 15B isoform 2 [Theobroma cacao] Length = 369 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARRVECNKC Sbjct: 105 DWHCPNPSCGNLNFARRVECNKC 127 >ref|XP_007016970.1| TBP-associated factor 15B isoform 1 [Theobroma cacao] gi|508787333|gb|EOY34589.1| TBP-associated factor 15B isoform 1 [Theobroma cacao] Length = 468 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARRVECNKC Sbjct: 105 DWHCPNPSCGNLNFARRVECNKC 127 >ref|XP_004145234.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101203985 [Cucumis sativus] Length = 465 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW+CPNP CGNLNFARRVECNKC Sbjct: 103 DWVCPNPGCGNLNFARRVECNKC 125 >ref|XP_007015000.1| Uncharacterized protein TCM_040624 [Theobroma cacao] gi|508785363|gb|EOY32619.1| Uncharacterized protein TCM_040624 [Theobroma cacao] Length = 367 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 12/111 (10%) Frame = +3 Query: 12 HHHLLFLDYHHKNHLFHCYNYCFYRHDSHQTHHHFLLCYNHLRH-------*HLQDLKHH 170 HH L+F++ HH +HL H + F H H H+LL + +L H H+ HH Sbjct: 158 HHLLMFINIHHHHHLRHVL-HMFTSLHLHHLHPHYLLMFINLHHHHHLHHLLHMFTSLHH 216 Query: 171 IYYTRP-FLQSSNSHNLD*GKANRLLFRSRN----HDRHLLDFVNLHHIPL 308 ++ P L +N H L + +F + + H HLL F+NLHH+ L Sbjct: 217 LHLHHPHHLMFTNLHLLHLHPHHLFMFTNLHHLHLHPHHLLMFINLHHLHL 267 >ref|XP_006641014.1| PREDICTED: TATA-binding protein-associated factor 2N-like [Lepisosteus oculatus] Length = 434 Score = 56.2 bits (134), Expect = 5e-06 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DWLCPNPSCGN+NFARR+ECN+C Sbjct: 356 DWLCPNPSCGNMNFARRMECNQC 378 >ref|XP_006401076.1| hypothetical protein EUTSA_v10012621mg [Eutrema salsugineum] gi|557102166|gb|ESQ42529.1| hypothetical protein EUTSA_v10012621mg [Eutrema salsugineum] Length = 904 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGN+NFARRVECNKC Sbjct: 567 DWRCPNPSCGNVNFARRVECNKC 589 >ref|XP_006281876.1| hypothetical protein CARUB_v10028073mg, partial [Capsella rubella] gi|482550580|gb|EOA14774.1| hypothetical protein CARUB_v10028073mg, partial [Capsella rubella] Length = 918 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGN+NFARRVECNKC Sbjct: 580 DWRCPNPSCGNVNFARRVECNKC 602 >dbj|BAB10262.1| unnamed protein product [Arabidopsis thaliana] Length = 363 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGN+NFARRVECNKC Sbjct: 87 DWRCPNPSCGNVNFARRVECNKC 109 >ref|XP_002866269.1| hypothetical protein ARALYDRAFT_495966 [Arabidopsis lyrata subsp. lyrata] gi|297312104|gb|EFH42528.1| hypothetical protein ARALYDRAFT_495966 [Arabidopsis lyrata subsp. lyrata] Length = 428 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGN+NFARRVECNKC Sbjct: 89 DWRCPNPSCGNVNFARRVECNKC 111 >gb|AAR28021.1| TAF15b [Arabidopsis thaliana] Length = 387 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGN+NFARRVECNKC Sbjct: 87 DWRCPNPSCGNVNFARRVECNKC 109 >ref|NP_851215.1| TBP-associated factor 15B [Arabidopsis thaliana] gi|30697077|ref|NP_568879.3| TBP-associated factor 15B [Arabidopsis thaliana] gi|75332298|sp|Q94KD0.1|TA15B_ARATH RecName: Full=Transcription initiation factor TFIID subunit 15b; AltName: Full=TBP-associated factor 15b; Short=AtTAF15b gi|14194175|gb|AAK56282.1|AF367294_1 AT5g58470/mqj2_60 [Arabidopsis thaliana] gi|18700145|gb|AAL77684.1| AT5g58470/mqj2_60 [Arabidopsis thaliana] gi|222423096|dbj|BAH19528.1| AT5G58470 [Arabidopsis thaliana] gi|332009673|gb|AED97056.1| TBP-associated factor 15B [Arabidopsis thaliana] gi|332009674|gb|AED97057.1| TBP-associated factor 15B [Arabidopsis thaliana] Length = 422 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGN+NFARRVECNKC Sbjct: 87 DWRCPNPSCGNVNFARRVECNKC 109 >ref|XP_006596908.1| PREDICTED: transcription initiation factor TFIID subunit 15b-like [Glycine max] Length = 284 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 237 DWLCPNPSCGNLNFARRVECNKC 169 DW CPNPSCGNLNFARR ECNKC Sbjct: 49 DWRCPNPSCGNLNFARRAECNKC 71