BLASTX nr result
ID: Akebia27_contig00020883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00020883 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034406.1| Glutathione-disulfide reductase isoform 1 [T... 80 4e-13 ref|XP_007222141.1| hypothetical protein PRUPE_ppa004673mg [Prun... 79 7e-13 ref|XP_002518118.1| glutathione reductase, putative [Ricinus com... 78 1e-12 ref|XP_004296631.1| PREDICTED: glutathione reductase, cytosolic-... 77 2e-12 ref|XP_002285672.1| PREDICTED: glutathione reductase, cytosolic ... 77 2e-12 emb|CAN65542.1| hypothetical protein VITISV_026403 [Vitis vinifera] 77 2e-12 gb|AGY14485.1| glutathione reductase, partial [Cicer arietinum] 77 3e-12 ref|XP_004514690.1| PREDICTED: glutathione reductase, cytosolic-... 77 3e-12 ref|XP_002299276.2| glutathione-disulfide reductase family prote... 76 6e-12 sp|Q43154.1|GSHRP_SPIOL RecName: Full=Glutathione reductase, chl... 75 7e-12 gb|AFK49613.1| unknown [Medicago truncatula] 75 7e-12 gb|ACJ85587.1| unknown [Medicago truncatula] 75 7e-12 ref|XP_002303826.1| glutathione-disulfide reductase family prote... 75 7e-12 gb|ABW96363.1| glutathione reductase [Ipomoea batatas] 75 9e-12 gb|AGG09347.1| gluthatione reductase [Vitis vinifera] 75 1e-11 gb|ABB89042.1| glutathione reductase [Vigna unguiculata] 75 1e-11 ref|XP_007151881.1| hypothetical protein PHAVU_004G083600g [Phas... 73 4e-11 sp|Q43621.1|GSHRC_PEA RecName: Full=Glutathione reductase, cytos... 73 4e-11 gb|AFK45920.1| unknown [Lotus japonicus] 73 4e-11 gb|EXB87094.1| Glutathione reductase [Morus notabilis] 72 8e-11 >ref|XP_007034406.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] gi|590656908|ref|XP_007034407.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] gi|508713435|gb|EOY05332.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] gi|508713436|gb|EOY05333.1| Glutathione-disulfide reductase isoform 1 [Theobroma cacao] Length = 496 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRSV+RR+ AGGKPKTNL Sbjct: 456 GATKAQFDSTVGIHPSAAEEFVTMRSVSRRITAGGKPKTNL 496 >ref|XP_007222141.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|596129772|ref|XP_007222142.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|462419077|gb|EMJ23340.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] gi|462419078|gb|EMJ23341.1| hypothetical protein PRUPE_ppa004673mg [Prunus persica] Length = 496 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRSVTRR+ AG KPKTNL Sbjct: 456 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRIAAGSKPKTNL 496 >ref|XP_002518118.1| glutathione reductase, putative [Ricinus communis] gi|223542714|gb|EEF44251.1| glutathione reductase, putative [Ricinus communis] Length = 496 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRS+TRRV AG KPKTNL Sbjct: 456 GATKAQFDSTVGIHPSAAEEFVTMRSLTRRVNAGNKPKTNL 496 >ref|XP_004296631.1| PREDICTED: glutathione reductase, cytosolic-like [Fragaria vesca subsp. vesca] gi|400234892|gb|AFP74110.1| glutathione reductase [Fragaria x ananassa] Length = 496 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRV A GKPKT L Sbjct: 456 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVSASGKPKTTL 496 >ref|XP_002285672.1| PREDICTED: glutathione reductase, cytosolic [Vitis vinifera] gi|297741929|emb|CBI33364.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFD TVGIHPSAAEEFVTMRSVTRR+ AG KPKTNL Sbjct: 456 GATKAQFDCTVGIHPSAAEEFVTMRSVTRRIAAGNKPKTNL 496 >emb|CAN65542.1| hypothetical protein VITISV_026403 [Vitis vinifera] Length = 215 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFD TVGIHPSAAEEFVTMRSVTRR+ AG KPKTNL Sbjct: 175 GATKAQFDCTVGIHPSAAEEFVTMRSVTRRIAAGNKPKTNL 215 >gb|AGY14485.1| glutathione reductase, partial [Cicer arietinum] Length = 382 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVG+HPSAAEEFVTMRSVTRRV A KPKTNL Sbjct: 342 GATKAQFDSTVGVHPSAAEEFVTMRSVTRRVTAAAKPKTNL 382 >ref|XP_004514690.1| PREDICTED: glutathione reductase, cytosolic-like [Cicer arietinum] Length = 498 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVG+HPSAAEEFVTMRSVTRRV A KPKTNL Sbjct: 458 GATKAQFDSTVGVHPSAAEEFVTMRSVTRRVTAAAKPKTNL 498 >ref|XP_002299276.2| glutathione-disulfide reductase family protein [Populus trichocarpa] gi|550347245|gb|EEE84081.2| glutathione-disulfide reductase family protein [Populus trichocarpa] Length = 499 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKT 328 GATK QFDSTVGIHPSAAEEFVTMRSVTRRV AGGKPKT Sbjct: 458 GATKQQFDSTVGIHPSAAEEFVTMRSVTRRVTAGGKPKT 496 >sp|Q43154.1|GSHRP_SPIOL RecName: Full=Glutathione reductase, chloroplastic; Short=GR; Short=GRase; Flags: Precursor gi|529375|dbj|BAA07108.1| glutathione reductase precursor [Spinacia oleracea] Length = 489 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMR +RRVP GKPKTNL Sbjct: 449 GATKAQFDSTVGIHPSAAEEFVTMREPSRRVPGAGKPKTNL 489 >gb|AFK49613.1| unknown [Medicago truncatula] Length = 498 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRV KPKTNL Sbjct: 458 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVTGSAKPKTNL 498 >gb|ACJ85587.1| unknown [Medicago truncatula] Length = 275 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRV KPKTNL Sbjct: 235 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVTGSAKPKTNL 275 >ref|XP_002303826.1| glutathione-disulfide reductase family protein [Populus trichocarpa] gi|118488346|gb|ABK95991.1| unknown [Populus trichocarpa] gi|222841258|gb|EEE78805.1| glutathione-disulfide reductase family protein [Populus trichocarpa] Length = 498 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATK QFDSTVGIHPSAAEEFVTMRSV RRV A GKPKTNL Sbjct: 458 GATKQQFDSTVGIHPSAAEEFVTMRSVARRVTASGKPKTNL 498 >gb|ABW96363.1| glutathione reductase [Ipomoea batatas] Length = 494 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTMRSVTR VP KPKTNL Sbjct: 454 GATKAQFDSTVGIHPSAAEEFVTMRSVTRVVPPASKPKTNL 494 >gb|AGG09347.1| gluthatione reductase [Vitis vinifera] Length = 496 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFD TVGIHPSAAEE VTMRSVTRR+ AG KPKTNL Sbjct: 456 GATKAQFDCTVGIHPSAAEELVTMRSVTRRIAAGNKPKTNL 496 >gb|ABB89042.1| glutathione reductase [Vigna unguiculata] Length = 499 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATK QFDSTVGIHPSAAEEFVTMR+VTRRV GKPKTNL Sbjct: 459 GATKEQFDSTVGIHPSAAEEFVTMRTVTRRVTGSGKPKTNL 499 >ref|XP_007151881.1| hypothetical protein PHAVU_004G083600g [Phaseolus vulgaris] gi|561025190|gb|ESW23875.1| hypothetical protein PHAVU_004G083600g [Phaseolus vulgaris] Length = 274 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSA+EEFVTMR+VTR V GKPKTNL Sbjct: 234 GATKAQFDSTVGIHPSASEEFVTMRTVTRTVTGNGKPKTNL 274 >sp|Q43621.1|GSHRC_PEA RecName: Full=Glutathione reductase, cytosolic; Short=GR; Short=GRase; AltName: Full=GOR2 gi|1370285|emb|CAA66924.1| glutathione reductase [Pisum sativum] Length = 498 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPS+AEEFVTMRS TRRV G KPKTNL Sbjct: 458 GATKAQFDSTVGIHPSSAEEFVTMRSETRRVTGGVKPKTNL 498 >gb|AFK45920.1| unknown [Lotus japonicus] Length = 275 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQFDSTVGIHPSAAEEFVTM+SVTRRV KPKTNL Sbjct: 235 GATKAQFDSTVGIHPSAAEEFVTMQSVTRRVTGTAKPKTNL 275 >gb|EXB87094.1| Glutathione reductase [Morus notabilis] Length = 505 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 444 GATKAQFDSTVGIHPSAAEEFVTMRSVTRRVPAGGKPKTNL 322 GATKAQ DSTVGIHPSAAEEFVTMR+ TRRV GKPKTNL Sbjct: 465 GATKAQLDSTVGIHPSAAEEFVTMRTETRRVSGSGKPKTNL 505