BLASTX nr result
ID: Akebia27_contig00020455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00020455 (747 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480898.1| PREDICTED: BEL1-like homeodomain protein 9-l... 58 3e-06 ref|XP_006429214.1| hypothetical protein CICLE_v10011268mg [Citr... 58 3e-06 >ref|XP_006480898.1| PREDICTED: BEL1-like homeodomain protein 9-like [Citrus sinensis] Length = 641 Score = 58.2 bits (139), Expect = 3e-06 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +3 Query: 435 FPPKKLGNELM-NFSYNNLSNHHHVGFGISAAGGNSGVYLTLGL 563 FP +GNE N SYN+LSNH HVG G+S AGGNSGV LTLGL Sbjct: 540 FPDIPVGNEEPPNLSYNSLSNHPHVGVGVSMAGGNSGVSLTLGL 583 >ref|XP_006429214.1| hypothetical protein CICLE_v10011268mg [Citrus clementina] gi|557531271|gb|ESR42454.1| hypothetical protein CICLE_v10011268mg [Citrus clementina] Length = 641 Score = 58.2 bits (139), Expect = 3e-06 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +3 Query: 435 FPPKKLGNELM-NFSYNNLSNHHHVGFGISAAGGNSGVYLTLGL 563 FP +GNE N SYN+LSNH HVG G+S AGGNSGV LTLGL Sbjct: 540 FPDIPVGNEEPPNLSYNSLSNHPHVGVGVSMAGGNSGVSLTLGL 583