BLASTX nr result
ID: Akebia27_contig00020422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00020422 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386533.1| hypothetical protein POPTR_0002s13580g [Popu... 61 2e-07 >ref|XP_006386533.1| hypothetical protein POPTR_0002s13580g [Populus trichocarpa] gi|550344948|gb|ERP64330.1| hypothetical protein POPTR_0002s13580g [Populus trichocarpa] Length = 171 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -1 Query: 346 DEYSREHSSFPTSMECDEQPIEPISDIGIDQVNDLMFN 233 DE+SRE S+F S+E DEQPIEPISDIGI+++NDLMFN Sbjct: 131 DEFSREPSTFIPSLEGDEQPIEPISDIGINKINDLMFN 168