BLASTX nr result
ID: Akebia27_contig00020154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00020154 (596 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492851.1| PREDICTED: metal tolerance protein C2-like [... 57 4e-06 ref|XP_006429885.1| hypothetical protein CICLE_v10011987mg [Citr... 57 4e-06 ref|XP_004304358.1| PREDICTED: metal tolerance protein C2-like [... 56 7e-06 ref|XP_004493594.1| PREDICTED: metal tolerance protein C2-like [... 56 9e-06 ref|XP_007202062.1| hypothetical protein PRUPE_ppa006837mg [Prun... 56 9e-06 ref|XP_002530715.1| cation efflux protein/ zinc transporter, put... 56 9e-06 >ref|XP_006492851.1| PREDICTED: metal tolerance protein C2-like [Citrus sinensis] Length = 373 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 594 KGADDRSILQYVHGLYHDLGVQDLTVQTDH 505 KG DDR ILQ+VHGLYHDLGVQDLTVQ D+ Sbjct: 343 KGVDDRPILQFVHGLYHDLGVQDLTVQIDY 372 >ref|XP_006429885.1| hypothetical protein CICLE_v10011987mg [Citrus clementina] gi|557531942|gb|ESR43125.1| hypothetical protein CICLE_v10011987mg [Citrus clementina] Length = 373 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 594 KGADDRSILQYVHGLYHDLGVQDLTVQTDH 505 KG DDR ILQ+VHGLYHDLGVQDLTVQ D+ Sbjct: 343 KGVDDRPILQFVHGLYHDLGVQDLTVQIDY 372 >ref|XP_004304358.1| PREDICTED: metal tolerance protein C2-like [Fragaria vesca subsp. vesca] Length = 383 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 594 KGADDRSILQYVHGLYHDLGVQDLTVQTDHI 502 KG DDR +LQ VHGLYHDLG+QDL VQ DH+ Sbjct: 353 KGIDDRPVLQLVHGLYHDLGIQDLAVQADHV 383 >ref|XP_004493594.1| PREDICTED: metal tolerance protein C2-like [Cicer arietinum] Length = 385 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 594 KGADDRSILQYVHGLYHDLGVQDLTVQTDH 505 KG DDR IL++VHGLYHDLGVQDLTVQ D+ Sbjct: 355 KGVDDRPILEFVHGLYHDLGVQDLTVQIDY 384 >ref|XP_007202062.1| hypothetical protein PRUPE_ppa006837mg [Prunus persica] gi|462397593|gb|EMJ03261.1| hypothetical protein PRUPE_ppa006837mg [Prunus persica] Length = 393 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 594 KGADDRSILQYVHGLYHDLGVQDLTVQTDHI 502 KG DDR ILQ VHGLYHDLG+QDLTVQ D++ Sbjct: 363 KGIDDRPILQLVHGLYHDLGIQDLTVQADNV 393 >ref|XP_002530715.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] gi|223529729|gb|EEF31669.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] Length = 321 Score = 55.8 bits (133), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 594 KGADDRSILQYVHGLYHDLGVQDLTVQTDH 505 KG DDR IL++VHGLYHDLGVQDL VQTD+ Sbjct: 291 KGVDDRPILEFVHGLYHDLGVQDLIVQTDY 320