BLASTX nr result
ID: Akebia27_contig00019855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00019855 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC07317.1| hypothetical protein L484_021225 [Morus notabilis] 87 3e-15 ref|XP_006473439.1| PREDICTED: putative pentatricopeptide repeat... 82 1e-13 ref|XP_006434922.1| hypothetical protein CICLE_v10003562mg [Citr... 78 1e-12 ref|XP_004293229.1| PREDICTED: putative pentatricopeptide repeat... 69 5e-10 ref|XP_002281859.2| PREDICTED: putative pentatricopeptide repeat... 69 9e-10 emb|CAN66818.1| hypothetical protein VITISV_004776 [Vitis vinifera] 69 9e-10 ref|XP_002510334.1| pentatricopeptide repeat-containing protein,... 65 1e-08 ref|XP_007017448.1| Pentatricopeptide repeat superfamily protein... 63 5e-08 ref|XP_006375054.1| hypothetical protein POPTR_0014s03970g [Popu... 60 2e-07 ref|XP_004154904.1| PREDICTED: putative pentatricopeptide repeat... 60 4e-07 ref|XP_004147817.1| PREDICTED: putative pentatricopeptide repeat... 60 4e-07 ref|XP_003595590.1| hypothetical protein MTR_2g049740 [Medicago ... 57 2e-06 ref|XP_006856131.1| hypothetical protein AMTR_s00059p00156460 [A... 57 3e-06 >gb|EXC07317.1| hypothetical protein L484_021225 [Morus notabilis] Length = 921 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/76 (53%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Frame = -3 Query: 225 FRSIRFIHQSYW-KESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSIDKLFFH 49 FR H W + S+H +R L+WKLRDEYKL++ EL+DRI R+L+L+RF++ID+L F Sbjct: 5 FRKTCVPHILLWPRRSLHVSRPLQWKLRDEYKLTRPELVDRISRLLVLQRFNAIDELSFQ 64 Query: 48 YSDEILDTVLQKLRFN 1 +SDE+LD+VL+KL+ N Sbjct: 65 FSDELLDSVLRKLKLN 80 >ref|XP_006473439.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X1 [Citrus sinensis] gi|568838908|ref|XP_006473440.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X2 [Citrus sinensis] gi|568838910|ref|XP_006473441.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X3 [Citrus sinensis] gi|568838912|ref|XP_006473442.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X4 [Citrus sinensis] gi|568838914|ref|XP_006473443.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X5 [Citrus sinensis] gi|568838916|ref|XP_006473444.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X6 [Citrus sinensis] gi|568838918|ref|XP_006473445.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X7 [Citrus sinensis] Length = 955 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/82 (50%), Positives = 57/82 (69%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQSYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSI 67 M RY+ F ++ + + +H +R L WK R EY+LSQ ELLDRI R+L+L RFD++ Sbjct: 1 MPRYTPFF-TLHLLPHLRPPQFLHVSRSLHWKPRHEYRLSQPELLDRITRLLVLGRFDAV 59 Query: 66 DKLFFHYSDEILDTVLQKLRFN 1 D L F +SD++LD+VLQKLR N Sbjct: 60 DNLSFDFSDDLLDSVLQKLRLN 81 >ref|XP_006434922.1| hypothetical protein CICLE_v10003562mg [Citrus clementina] gi|557537044|gb|ESR48162.1| hypothetical protein CICLE_v10003562mg [Citrus clementina] Length = 955 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/82 (47%), Positives = 56/82 (68%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQSYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSI 67 M RY+ F ++ + + +H +R L WK R EY+LS+ ELLDRI R+L+L RFD++ Sbjct: 1 MPRYTPFF-TLHLLPHLPPPQFLHVSRSLHWKPRHEYRLSRPELLDRITRLLVLGRFDAV 59 Query: 66 DKLFFHYSDEILDTVLQKLRFN 1 D L F +SD++LD+VL KLR N Sbjct: 60 DNLSFDFSDDLLDSVLHKLRLN 81 >ref|XP_004293229.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like [Fragaria vesca subsp. vesca] Length = 884 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/66 (45%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = -3 Query: 195 YWKESIHTTRV-LRWKLRDEYKLSQSELLDRICRILLLERFDSIDKLFFHYSDEILDTVL 19 + + +H +R + WK RDEYKL++ ELLDRI R+L+L+R+D+++ L F +SD++L++VL Sbjct: 7 FHRRPLHVSRTAVHWKPRDEYKLTRPELLDRISRLLVLQRYDALNNLSFEFSDQLLNSVL 66 Query: 18 QKLRFN 1 + L+ N Sbjct: 67 RNLKLN 72 >ref|XP_002281859.2| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like [Vitis vinifera] Length = 939 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/82 (46%), Positives = 52/82 (63%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQSYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSI 67 M RY SIF + + + IH +R L WKLRDE + EL+ RICR++LL R ++I Sbjct: 1 MHRYFSIFTP-PLPSRLHLRRPIHLSRTLLWKLRDESHPAPPELVSRICRLVLLRRCNAI 59 Query: 66 DKLFFHYSDEILDTVLQKLRFN 1 KL F +SD+I+D VL+ LR N Sbjct: 60 SKLNFVFSDDIVDAVLRNLRLN 81 >emb|CAN66818.1| hypothetical protein VITISV_004776 [Vitis vinifera] Length = 1037 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/82 (46%), Positives = 52/82 (63%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQSYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSI 67 M RY SIF + + + IH +R L WKLRDE + EL+ RICR++LL R ++I Sbjct: 1 MHRYFSIFTP-PLPSRLHLRRPIHLSRTLLWKLRDESHPAPPELVSRICRLVLLRRCNAI 59 Query: 66 DKLFFHYSDEILDTVLQKLRFN 1 KL F +SD+I+D VL+ LR N Sbjct: 60 SKLNFVFSDDIVDAVLRNLRLN 81 >ref|XP_002510334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551035|gb|EEF52521.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 947 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/82 (45%), Positives = 53/82 (64%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQSYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSI 67 M+RYS IF S+ + ++S H WK R E KL++ EL+DRI R+L+L R+ ++ Sbjct: 1 MLRYSPIFPSLSLLRL---RKSYH------WKPRHESKLTRPELIDRISRLLVLGRYHAL 51 Query: 66 DKLFFHYSDEILDTVLQKLRFN 1 L F +SD ILD+VL KL+FN Sbjct: 52 KDLNFQFSDYILDSVLLKLKFN 73 >ref|XP_007017448.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508722776|gb|EOY14673.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 937 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/62 (40%), Positives = 47/62 (75%) Frame = -3 Query: 186 ESIHTTRVLRWKLRDEYKLSQSELLDRICRILLLERFDSIDKLFFHYSDEILDTVLQKLR 7 +S H + L WKLR+E+ +++ +L+ RI R+L+L R+++++ L F +S+E+LD+VL+ L+ Sbjct: 21 QSFHASSPLHWKLREEFNITRPDLISRITRLLILGRYNALNDLSFDFSNELLDSVLRSLK 80 Query: 6 FN 1 N Sbjct: 81 LN 82 >ref|XP_006375054.1| hypothetical protein POPTR_0014s03970g [Populus trichocarpa] gi|550323368|gb|ERP52851.1| hypothetical protein POPTR_0014s03970g [Populus trichocarpa] Length = 948 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/54 (48%), Positives = 40/54 (74%) Frame = -3 Query: 162 LRWKLRDEYKLSQSELLDRICRILLLERFDSIDKLFFHYSDEILDTVLQKLRFN 1 + WK R E LS+ EL +RI R+L+L RFD+++ L FH+SD ++D++L KL+ N Sbjct: 21 IHWKPRHESNLSRPELHERISRLLILRRFDALENLNFHFSDSLVDSILVKLKLN 74 >ref|XP_004154904.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like [Cucumis sativus] Length = 567 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 6/88 (6%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQ------SYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLL 85 M Y IFR++R Q S + + +T L RDE KLSQ +L+DRI R+L+L Sbjct: 27 MAGYVDIFRAMRLQIQLLRQLPSLFICFLASTNAL---FRDELKLSQPDLVDRISRLLVL 83 Query: 84 ERFDSIDKLFFHYSDEILDTVLQKLRFN 1 RFD++ L F +S+E++D VL+ LR N Sbjct: 84 RRFDALANLSFSFSNELMDLVLRNLRLN 111 >ref|XP_004147817.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like [Cucumis sativus] Length = 942 Score = 59.7 bits (143), Expect = 4e-07 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 6/88 (6%) Frame = -3 Query: 246 MVRYSSIFRSIRFIHQ------SYWKESIHTTRVLRWKLRDEYKLSQSELLDRICRILLL 85 M Y IFR++R Q S + + +T L RDE KLSQ +L+DRI R+L+L Sbjct: 27 MAGYVDIFRAMRLQIQLLRQLPSLFICFLASTNAL---FRDELKLSQPDLVDRISRLLVL 83 Query: 84 ERFDSIDKLFFHYSDEILDTVLQKLRFN 1 RFD++ L F +S+E++D VL+ LR N Sbjct: 84 RRFDALANLSFSFSNELMDLVLRNLRLN 111 >ref|XP_003595590.1| hypothetical protein MTR_2g049740 [Medicago truncatula] gi|355484638|gb|AES65841.1| hypothetical protein MTR_2g049740 [Medicago truncatula] Length = 859 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/80 (43%), Positives = 49/80 (61%), Gaps = 4/80 (5%) Frame = -3 Query: 228 IFRSIRF---IHQSYWKESIHTTRVLRWKLRDEY-KLSQSELLDRICRILLLERFDSIDK 61 +FRS F I S + S H++ L+WKLR E L ELLDRI R+L+L R S+ Sbjct: 1 MFRSSLFKKPILLSLTQRSFHSSIPLQWKLRQETTNLPHPELLDRITRLLILNRPQSLHN 60 Query: 60 LFFHYSDEILDTVLQKLRFN 1 L F YSD + D++L++LR + Sbjct: 61 LTFKYSDHLTDSLLRRLRLH 80 >ref|XP_006856131.1| hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda] gi|548859990|gb|ERN17598.1| hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda] Length = 962 Score = 57.0 bits (136), Expect = 3e-06 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 1/85 (1%) Frame = -3 Query: 258 LSPEMVRYSSIFRSIRFIHQSYWKESIHTTR-VLRWKLRDEYKLSQSELLDRICRILLLE 82 LS M RY S+ + + +SIHTT +L+ K L+Q++L++ +CRIL+L Sbjct: 13 LSSAMSRYFSLITPLSLFPAA---KSIHTTTTLLQRKPNHGPPLTQTQLIETLCRILILN 69 Query: 81 RFDSIDKLFFHYSDEILDTVLQKLR 7 R ++I L F +SDE++D VL+KLR Sbjct: 70 RLEAISHLSFDFSDELVDGVLRKLR 94