BLASTX nr result
ID: Akebia27_contig00019681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00019681 (652 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847773.1| hypothetical protein AMTR_s00162p00052420 [A... 119 8e-25 ref|XP_007048797.1| Citrate synthase 2 isoform 1 [Theobroma caca... 117 3e-24 gb|EXB30285.1| Citrate synthase [Morus notabilis] 114 3e-23 ref|XP_002322875.1| Citrate synthase family protein [Populus tri... 112 8e-23 gb|EYU31620.1| hypothetical protein MIMGU_mgv1a004748mg [Mimulus... 112 1e-22 ref|XP_006448012.1| hypothetical protein CICLE_v10014944mg [Citr... 111 2e-22 gb|AHM22929.1| citrate synthase [Nicotiana tabacum] 111 2e-22 ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vi... 111 2e-22 ref|XP_004243239.1| PREDICTED: citrate synthase 3, peroxisomal-l... 110 3e-22 ref|XP_006348933.1| PREDICTED: citrate synthase 3, peroxisomal-l... 110 4e-22 ref|XP_004306283.1| PREDICTED: citrate synthase, glyoxysomal-lik... 107 2e-21 ref|XP_006402751.1| hypothetical protein EUTSA_v10005906mg [Eutr... 107 2e-21 ref|XP_002532688.1| citrate synthase, putative [Ricinus communis... 107 2e-21 ref|XP_006350017.1| PREDICTED: citrate synthase, glyoxysomal-lik... 107 4e-21 ref|XP_007217210.1| hypothetical protein PRUPE_ppa004363mg [Prun... 107 4e-21 ref|XP_004251813.1| PREDICTED: citrate synthase, glyoxysomal-lik... 106 7e-21 ref|XP_004167690.1| PREDICTED: citrate synthase, glyoxysomal-lik... 105 1e-20 ref|XP_004143228.1| PREDICTED: citrate synthase, glyoxysomal-lik... 105 1e-20 sp|P49299.1|CYSZ_CUCMA RecName: Full=Citrate synthase, glyoxysom... 104 2e-20 ref|XP_002881873.1| hypothetical protein ARALYDRAFT_483376 [Arab... 103 4e-20 >ref|XP_006847773.1| hypothetical protein AMTR_s00162p00052420 [Amborella trichopoda] gi|548851074|gb|ERN09354.1| hypothetical protein AMTR_s00162p00052420 [Amborella trichopoda] Length = 510 Score = 119 bits (298), Expect = 8e-25 Identities = 53/61 (86%), Positives = 60/61 (98%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTGVWLRHYMPL+ERLA++E D+LGQVS+SNATRRRL+GSG Sbjct: 450 HWRESLDDPDTKIMRPQQVYTGVWLRHYMPLKERLAASEADRLGQVSISNATRRRLAGSG 509 Query: 183 V 185 V Sbjct: 510 V 510 >ref|XP_007048797.1| Citrate synthase 2 isoform 1 [Theobroma cacao] gi|508701058|gb|EOX92954.1| Citrate synthase 2 isoform 1 [Theobroma cacao] Length = 511 Score = 117 bits (293), Expect = 3e-24 Identities = 52/61 (85%), Positives = 60/61 (98%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKI+RPQQVYTGVWLRHYMPL+ER+A+TEVDKL QVS+SNA+RRRL+GSG Sbjct: 451 HWRESLDDPDTKIIRPQQVYTGVWLRHYMPLKERMAATEVDKLSQVSISNASRRRLAGSG 510 Query: 183 V 185 V Sbjct: 511 V 511 >gb|EXB30285.1| Citrate synthase [Morus notabilis] Length = 516 Score = 114 bits (285), Expect = 3e-23 Identities = 51/61 (83%), Positives = 58/61 (95%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTGVWLRHYMPL+ER++S E D+L QVSVSNA+RRRL+GSG Sbjct: 456 HWRESLDDPDTKIMRPQQVYTGVWLRHYMPLQERISSNEADRLSQVSVSNASRRRLAGSG 515 Query: 183 V 185 V Sbjct: 516 V 516 >ref|XP_002322875.1| Citrate synthase family protein [Populus trichocarpa] gi|222867505|gb|EEF04636.1| Citrate synthase family protein [Populus trichocarpa] Length = 508 Score = 112 bits (281), Expect = 8e-23 Identities = 49/61 (80%), Positives = 57/61 (93%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTG WLRHYMPL+ER+ T+ D+LGQVS+SNA+RRRL+GSG Sbjct: 448 HWRESLDDPDTKIMRPQQVYTGEWLRHYMPLKERMIQTDADRLGQVSISNASRRRLAGSG 507 Query: 183 V 185 V Sbjct: 508 V 508 >gb|EYU31620.1| hypothetical protein MIMGU_mgv1a004748mg [Mimulus guttatus] Length = 512 Score = 112 bits (280), Expect = 1e-22 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRP QVYTGVWLRHYMPLRER+ + E DKLGQVSVSNAT+RRL+GSG Sbjct: 452 HWRESLDDPDTKIMRPAQVYTGVWLRHYMPLRERMDTREEDKLGQVSVSNATKRRLAGSG 511 >ref|XP_006448012.1| hypothetical protein CICLE_v10014944mg [Citrus clementina] gi|568878544|ref|XP_006492249.1| PREDICTED: citrate synthase, glyoxysomal-like [Citrus sinensis] gi|557550623|gb|ESR61252.1| hypothetical protein CICLE_v10014944mg [Citrus clementina] Length = 513 Score = 111 bits (278), Expect = 2e-22 Identities = 49/60 (81%), Positives = 55/60 (91%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTGVW+RHYMPL+ER+ D+LGQVSVSNATRRRL+GSG Sbjct: 453 HWRESLDDPDTKIMRPQQVYTGVWMRHYMPLKERMIEKNADRLGQVSVSNATRRRLAGSG 512 >gb|AHM22929.1| citrate synthase [Nicotiana tabacum] Length = 511 Score = 111 bits (277), Expect = 2e-22 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRP QVYTGVW+RHYMPL+ER TE DKLGQVSVSNAT+RRL+GSG Sbjct: 451 HWRESLDDPDTKIMRPAQVYTGVWMRHYMPLKERSPYTETDKLGQVSVSNATKRRLAGSG 510 >ref|XP_002284064.1| PREDICTED: citrate synthase, glyoxysomal [Vitis vinifera] gi|296086334|emb|CBI31775.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 111 bits (277), Expect = 2e-22 Identities = 48/61 (78%), Positives = 57/61 (93%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTG WLRH+MP++ER+ S E D+LGQVS+SNATRRRL+GSG Sbjct: 452 HWRESLDDPDTKIMRPQQVYTGEWLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGSG 511 Query: 183 V 185 + Sbjct: 512 M 512 >ref|XP_004243239.1| PREDICTED: citrate synthase 3, peroxisomal-like [Solanum lycopersicum] Length = 511 Score = 110 bits (276), Expect = 3e-22 Identities = 51/60 (85%), Positives = 54/60 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRP QVYTGVWLRHY+PLR R STE DK GQVSVSNATRRRL+GSG Sbjct: 451 HWRESLDDPDTKIMRPAQVYTGVWLRHYVPLRGRSPSTETDKFGQVSVSNATRRRLAGSG 510 >ref|XP_006348933.1| PREDICTED: citrate synthase 3, peroxisomal-like [Solanum tuberosum] Length = 511 Score = 110 bits (275), Expect = 4e-22 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRP QVYTGVWLRHYMPL++R S E DK GQVSVSNATRRRL+GSG Sbjct: 451 HWRESLDDPDTKIMRPAQVYTGVWLRHYMPLQDRSPSAETDKFGQVSVSNATRRRLAGSG 510 >ref|XP_004306283.1| PREDICTED: citrate synthase, glyoxysomal-like [Fragaria vesca subsp. vesca] Length = 507 Score = 107 bits (268), Expect = 2e-21 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRP QVY G WLRHYMPL+ER+ S++ DKL QVSVSNA++RRLSGSG Sbjct: 447 HWRESLDDPDTKIMRPAQVYVGAWLRHYMPLKERIVSSDGDKLSQVSVSNASKRRLSGSG 506 Query: 183 V 185 V Sbjct: 507 V 507 >ref|XP_006402751.1| hypothetical protein EUTSA_v10005906mg [Eutrema salsugineum] gi|312282631|dbj|BAJ34181.1| unnamed protein product [Thellungiella halophila] gi|557103850|gb|ESQ44204.1| hypothetical protein EUTSA_v10005906mg [Eutrema salsugineum] Length = 508 Score = 107 bits (268), Expect = 2e-21 Identities = 48/61 (78%), Positives = 55/61 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQ YTGVWLRHY P+RER S++ DKLGQVS+SNA+RRRLSGS Sbjct: 448 HWRESLDDPDTKIMRPQQAYTGVWLRHYEPVRERTLSSDSDKLGQVSISNASRRRLSGSA 507 Query: 183 V 185 + Sbjct: 508 L 508 >ref|XP_002532688.1| citrate synthase, putative [Ricinus communis] gi|223527571|gb|EEF29688.1| citrate synthase, putative [Ricinus communis] Length = 467 Score = 107 bits (268), Expect = 2e-21 Identities = 46/61 (75%), Positives = 57/61 (93%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTG WLRHYMP++ER+ + +D+LGQVSVSNA++RRL+GSG Sbjct: 407 HWRESLDDPDTKIMRPQQVYTGEWLRHYMPIKERMQAGNIDQLGQVSVSNASKRRLAGSG 466 Query: 183 V 185 + Sbjct: 467 L 467 >ref|XP_006350017.1| PREDICTED: citrate synthase, glyoxysomal-like [Solanum tuberosum] Length = 514 Score = 107 bits (266), Expect = 4e-21 Identities = 47/60 (78%), Positives = 54/60 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HW+ES+DDPDTKIMRP QVYTGVW+RHYMPL+ER +E DKLG VSVSNAT+RRL+GSG Sbjct: 454 HWKESLDDPDTKIMRPAQVYTGVWMRHYMPLKERSPHSEADKLGHVSVSNATKRRLAGSG 513 >ref|XP_007217210.1| hypothetical protein PRUPE_ppa004363mg [Prunus persica] gi|462413360|gb|EMJ18409.1| hypothetical protein PRUPE_ppa004363mg [Prunus persica] Length = 514 Score = 107 bits (266), Expect = 4e-21 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKIMRPQQVYTG WLRHY+P RER+ +++ DKL QVSVSNA+RRRL+GSG Sbjct: 454 HWRESLDDPDTKIMRPQQVYTGNWLRHYIPPRERIVTSDSDKLSQVSVSNASRRRLAGSG 513 Query: 183 V 185 V Sbjct: 514 V 514 >ref|XP_004251813.1| PREDICTED: citrate synthase, glyoxysomal-like [Solanum lycopersicum] Length = 514 Score = 106 bits (264), Expect = 7e-21 Identities = 47/60 (78%), Positives = 53/60 (88%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HW ES+DDPDTKIMRP QVYTGVW+RHYMPL+ER +E DKLG VSVSNAT+RRL+GSG Sbjct: 454 HWNESLDDPDTKIMRPAQVYTGVWMRHYMPLKERSPHSEADKLGHVSVSNATKRRLAGSG 513 >ref|XP_004167690.1| PREDICTED: citrate synthase, glyoxysomal-like [Cucumis sativus] Length = 512 Score = 105 bits (262), Expect = 1e-20 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKI+RPQQVYTG WLRHY+P +ERL + D+LGQVSVSNA++RRLSGSG Sbjct: 452 HWRESLDDPDTKIIRPQQVYTGEWLRHYIPPKERLVPAKADRLGQVSVSNASKRRLSGSG 511 Query: 183 V 185 + Sbjct: 512 I 512 >ref|XP_004143228.1| PREDICTED: citrate synthase, glyoxysomal-like [Cucumis sativus] Length = 612 Score = 105 bits (262), Expect = 1e-20 Identities = 46/61 (75%), Positives = 55/61 (90%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKI+RPQQVYTG WLRHY+P +ERL + D+LGQVSVSNA++RRLSGSG Sbjct: 552 HWRESLDDPDTKIIRPQQVYTGEWLRHYIPPKERLVPAKADRLGQVSVSNASKRRLSGSG 611 Query: 183 V 185 + Sbjct: 612 I 612 >sp|P49299.1|CYSZ_CUCMA RecName: Full=Citrate synthase, glyoxysomal; AltName: Full=GCS; Flags: Precursor gi|1084323|pir||S53007 citrate synthase - cucurbit gi|975633|dbj|BAA07328.1| glyoxysomal citrate synthase [Cucurbita cv. Kurokawa Amakuri] Length = 516 Score = 104 bits (260), Expect = 2e-20 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLASTEVDKLGQVSVSNATRRRLSGSG 182 HWRES+DDPDTKI+RPQQVYTG WLRHY+P ERL + D+LGQVSVSNA++RRLSGSG Sbjct: 456 HWRESLDDPDTKIIRPQQVYTGEWLRHYIPPNERLVPAKADRLGQVSVSNASKRRLSGSG 515 Query: 183 V 185 + Sbjct: 516 I 516 >ref|XP_002881873.1| hypothetical protein ARALYDRAFT_483376 [Arabidopsis lyrata subsp. lyrata] gi|297327712|gb|EFH58132.1| hypothetical protein ARALYDRAFT_483376 [Arabidopsis lyrata subsp. lyrata] Length = 509 Score = 103 bits (258), Expect = 4e-20 Identities = 49/64 (76%), Positives = 55/64 (85%), Gaps = 3/64 (4%) Frame = +3 Query: 3 HWRESIDDPDTKIMRPQQVYTGVWLRHYMPLRERLA---STEVDKLGQVSVSNATRRRLS 173 HW+ES+DDPDTKIMRPQQVYTGVWLRHY P+RER+ S E DKLGQVS SNA+RRRL+ Sbjct: 446 HWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVSTSNASRRRLA 505 Query: 174 GSGV 185 GS V Sbjct: 506 GSSV 509