BLASTX nr result
ID: Akebia27_contig00019487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00019487 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205008.1| hypothetical protein PRUPE_ppa003625mg [Prun... 71 2e-10 gb|EYU42918.1| hypothetical protein MIMGU_mgv1a0045111mg, partia... 70 4e-10 ref|XP_006651399.1| PREDICTED: branched-chain-amino-acid aminotr... 69 5e-10 ref|XP_006577254.1| PREDICTED: amino acid aminotransferase isofo... 69 5e-10 ref|XP_007147073.1| hypothetical protein PHAVU_006G094000g [Phas... 69 5e-10 ref|XP_006850820.1| hypothetical protein AMTR_s00025p00125190 [A... 69 5e-10 ref|XP_004984311.1| PREDICTED: branched-chain-amino-acid aminotr... 69 5e-10 ref|XP_004139364.1| PREDICTED: branched-chain-amino-acid aminotr... 69 5e-10 ref|XP_002512341.1| branched-chain amino acid aminotransferase, ... 69 5e-10 gb|EEE59086.1| hypothetical protein OsJ_10916 [Oryza sativa Japo... 69 5e-10 gb|EEC75297.1| hypothetical protein OsI_11647 [Oryza sativa Indi... 69 5e-10 ref|NP_001150217.1| LOC100283847 [Zea mays] gi|195637620|gb|ACG3... 69 5e-10 gb|ABF96064.1| branched-chain amino acid aminotransferase, putat... 69 5e-10 gb|ABF96063.1| branched-chain amino acid aminotransferase, putat... 69 5e-10 gb|ABF96062.1| branched-chain amino acid aminotransferase, putat... 69 5e-10 gb|EXC31821.1| Branched-chain-amino-acid aminotransferase-like p... 69 7e-10 ref|XP_001746627.1| hypothetical protein [Monosiga brevicollis M... 69 7e-10 ref|XP_006471888.1| PREDICTED: LOW QUALITY PROTEIN: branched-cha... 68 1e-09 ref|XP_006433174.1| hypothetical protein CICLE_v10003913mg [Citr... 68 1e-09 gb|EMT09888.1| Branched-chain-amino-acid aminotransferase-like p... 68 1e-09 >ref|XP_007205008.1| hypothetical protein PRUPE_ppa003625mg [Prunus persica] gi|462400650|gb|EMJ06207.1| hypothetical protein PRUPE_ppa003625mg [Prunus persica] Length = 561 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGD+VWEGLRVYNGKIFKLDEHLDRL Sbjct: 287 SVFDSVVQGGDSVWEGLRVYNGKIFKLDEHLDRL 320 >gb|EYU42918.1| hypothetical protein MIMGU_mgv1a0045111mg, partial [Mimulus guttatus] Length = 337 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+YNGK+FKL+EHLDRL Sbjct: 61 SVFDSVVQGGDAVWEGLRIYNGKVFKLEEHLDRL 94 >ref|XP_006651399.1| PREDICTED: branched-chain-amino-acid aminotransferase-like protein 1-like [Oryza brachyantha] Length = 561 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 285 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 318 >ref|XP_006577254.1| PREDICTED: amino acid aminotransferase isoform X2 [Glycine max] Length = 557 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGD+VWEGLRVYNGKIFKL+EHLDRL Sbjct: 281 SVFDSVVQGGDSVWEGLRVYNGKIFKLEEHLDRL 314 >ref|XP_007147073.1| hypothetical protein PHAVU_006G094000g [Phaseolus vulgaris] gi|561020296|gb|ESW19067.1| hypothetical protein PHAVU_006G094000g [Phaseolus vulgaris] Length = 955 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGD+VWEGLRVYNGKIFKL+EHLDRL Sbjct: 679 SVFDSVVQGGDSVWEGLRVYNGKIFKLEEHLDRL 712 >ref|XP_006850820.1| hypothetical protein AMTR_s00025p00125190 [Amborella trichopoda] gi|548854491|gb|ERN12401.1| hypothetical protein AMTR_s00025p00125190 [Amborella trichopoda] Length = 556 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLRVYNGK+FKLD HLDRL Sbjct: 282 SVFDSVVQGGDAVWEGLRVYNGKLFKLDRHLDRL 315 >ref|XP_004984311.1| PREDICTED: branched-chain-amino-acid aminotransferase-like protein 1-like [Setaria italica] Length = 564 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 288 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 321 >ref|XP_004139364.1| PREDICTED: branched-chain-amino-acid aminotransferase-like protein 2-like [Cucumis sativus] Length = 934 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRLVKLNK 117 S FDSVVQGGD+VWEGLRVY GKIFKLDEHLDRL +K Sbjct: 676 SVFDSVVQGGDSVWEGLRVYRGKIFKLDEHLDRLFDSSK 714 >ref|XP_002512341.1| branched-chain amino acid aminotransferase, putative [Ricinus communis] gi|223548302|gb|EEF49793.1| branched-chain amino acid aminotransferase, putative [Ricinus communis] Length = 378 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGD+VWEGLRVYNGKIFKL+EHLDRL Sbjct: 102 SVFDSVVQGGDSVWEGLRVYNGKIFKLEEHLDRL 135 >gb|EEE59086.1| hypothetical protein OsJ_10916 [Oryza sativa Japonica Group] Length = 563 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 287 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 320 >gb|EEC75297.1| hypothetical protein OsI_11647 [Oryza sativa Indica Group] Length = 563 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 287 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 320 >ref|NP_001150217.1| LOC100283847 [Zea mays] gi|195637620|gb|ACG38278.1| aminotransferase, class IV family protein [Zea mays] gi|414866905|tpg|DAA45462.1| TPA: aminotransferase, class IV family protein [Zea mays] Length = 559 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 283 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 316 >gb|ABF96064.1| branched-chain amino acid aminotransferase, putative, expressed [Oryza sativa Japonica Group] Length = 513 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 287 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 320 >gb|ABF96063.1| branched-chain amino acid aminotransferase, putative, expressed [Oryza sativa Japonica Group] Length = 458 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 182 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 215 >gb|ABF96062.1| branched-chain amino acid aminotransferase, putative, expressed [Oryza sativa Japonica Group] gi|215706429|dbj|BAG93285.1| unnamed protein product [Oryza sativa Japonica Group] Length = 408 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGDAVWEGLR+Y+GK+FKLDEHLDRL Sbjct: 182 SVFDSVVQGGDAVWEGLRIYDGKVFKLDEHLDRL 215 >gb|EXC31821.1| Branched-chain-amino-acid aminotransferase-like protein 2 [Morus notabilis] Length = 600 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDSVVQGGD+VWEGLR+YNGKIFKL+EHLDRL Sbjct: 286 SVFDSVVQGGDSVWEGLRIYNGKIFKLEEHLDRL 319 >ref|XP_001746627.1| hypothetical protein [Monosiga brevicollis MX1] gi|163774897|gb|EDQ88523.1| predicted protein [Monosiga brevicollis MX1] Length = 1499 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRLV 105 SAFDS VQGGDAVWEGLRVYNG+IF LD+HLDRLV Sbjct: 1223 SAFDSAVQGGDAVWEGLRVYNGRIFNLDKHLDRLV 1257 >ref|XP_006471888.1| PREDICTED: LOW QUALITY PROTEIN: branched-chain-amino-acid aminotransferase-like protein 1-like [Citrus sinensis] Length = 938 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDS+VQGGD VWEGLRVYNGK+FKL+EHLDRL Sbjct: 665 SVFDSIVQGGDGVWEGLRVYNGKVFKLEEHLDRL 698 >ref|XP_006433174.1| hypothetical protein CICLE_v10003913mg [Citrus clementina] gi|557535296|gb|ESR46414.1| hypothetical protein CICLE_v10003913mg [Citrus clementina] Length = 925 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRL 102 S FDS+VQGGD VWEGLRVYNGK+FKL+EHLDRL Sbjct: 652 SVFDSIVQGGDGVWEGLRVYNGKVFKLEEHLDRL 685 >gb|EMT09888.1| Branched-chain-amino-acid aminotransferase-like protein 1 [Aegilops tauschii] Length = 581 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 1 SAFDSVVQGGDAVWEGLRVYNGKIFKLDEHLDRLVKLNK 117 S FDSVVQGGDAVWEGLR+Y+GK+FKL+EHLDRL K Sbjct: 224 SVFDSVVQGGDAVWEGLRIYDGKVFKLEEHLDRLFDSTK 262