BLASTX nr result
ID: Akebia27_contig00019043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00019043 (1099 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353602.1| PREDICTED: putative ribonuclease H protein A... 59 3e-06 emb|CAN70998.1| hypothetical protein VITISV_023635 [Vitis vinifera] 59 3e-06 >ref|XP_006353602.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum tuberosum] Length = 517 Score = 59.3 bits (142), Expect = 3e-06 Identities = 26/73 (35%), Positives = 37/73 (50%) Frame = -3 Query: 1094 INWVFPRKFSSLLVEWNSNTFHTRKRFLWTMLPSAIAWGVWNERNNRVFNNKIGSPHAGF 915 +NW P + S++L W ++ W ++PS I W VW ERNNR F+N+ S H Sbjct: 429 LNWTMPERTSNVLKSWVRRGSTKSQKRWWRLIPSCIWWSVWKERNNRCFDNRSNSIHKVK 488 Query: 914 LEILGLLYFWSNQ 876 + L FW Q Sbjct: 489 WNCIVSLLFWCKQ 501 >emb|CAN70998.1| hypothetical protein VITISV_023635 [Vitis vinifera] Length = 501 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/84 (33%), Positives = 43/84 (51%) Frame = -3 Query: 1088 WVFPRKFSSLLVEWNSNTFHTRKRFLWTMLPSAIAWGVWNERNNRVFNNKIGSPHAGFLE 909 WVFP +LL+EW R+ +W M+P + W +W ERN R+F + S + Sbjct: 416 WVFPNSVRNLLLEWKIKGLEKRRSVVWKMVPICLFWCIWGERNRRMFQEEEKSDMSLKNL 475 Query: 908 ILGLLYFWSNQNIDFVGITFDNFV 837 L +L WS Q +D ++F N + Sbjct: 476 FLRVLLEWSQQVMDVDFLSFMNLL 499