BLASTX nr result
ID: Akebia27_contig00018710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00018710 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284049.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 ... 83 3e-14 ref|XP_004303054.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 81 1e-13 ref|XP_006481928.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 81 2e-13 ref|XP_006481927.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 81 2e-13 ref|XP_006430344.1| hypothetical protein CICLE_v100109402mg, par... 81 2e-13 gb|EXB75953.1| E3 ubiquitin-protein ligase UPL7 [Morus notabilis] 80 4e-13 ref|XP_006366787.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 80 4e-13 ref|XP_002322903.2| hypothetical protein POPTR_0016s10980g [Popu... 79 5e-13 ref|XP_002528627.1| ubiquitin-protein ligase, putative [Ricinus ... 79 5e-13 ref|XP_003553574.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 ... 78 1e-12 gb|AEJ54425.1| ubiquitin-protein ligase UPL7 [Fagopyrum esculent... 78 1e-12 ref|XP_007204674.1| hypothetical protein PRUPE_ppa000451mg [Prun... 78 1e-12 gb|EPS71373.1| ubiquitin-protein ligase 7, partial [Genlisea aurea] 77 2e-12 ref|XP_004246588.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 77 2e-12 ref|XP_004494118.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 77 2e-12 gb|ADE75928.1| unknown [Picea sitchensis] 77 2e-12 ref|XP_006403726.1| hypothetical protein EUTSA_v10010078mg [Eutr... 76 4e-12 ref|XP_007027557.1| E3 ubiquitin-protein ligase UPL7 isoform 6 [... 76 6e-12 ref|XP_007027554.1| E3 ubiquitin-protein ligase UPL7 isoform 3, ... 75 7e-12 ref|XP_007027553.1| E3 ubiquitin-protein ligase UPL7 isoform 2 [... 75 7e-12 >ref|XP_002284049.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 [Vitis vinifera] gi|297740027|emb|CBI30209.3| unnamed protein product [Vitis vinifera] Length = 1161 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I GFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV Sbjct: 1067 ITGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 1105 >ref|XP_004303054.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like [Fragaria vesca subsp. vesca] Length = 1166 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I+GFEP ERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV Sbjct: 1072 ISGFEPTERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 1110 >ref|XP_006481928.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X2 [Citrus sinensis] Length = 1036 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 + GFEPKERCMLLKFVTSCSRAPLLGFKHLQP+FTIHKV Sbjct: 942 VEGFEPKERCMLLKFVTSCSRAPLLGFKHLQPSFTIHKV 980 >ref|XP_006481927.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Citrus sinensis] Length = 1150 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 + GFEPKERCMLLKFVTSCSRAPLLGFKHLQP+FTIHKV Sbjct: 1056 VEGFEPKERCMLLKFVTSCSRAPLLGFKHLQPSFTIHKV 1094 >ref|XP_006430344.1| hypothetical protein CICLE_v100109402mg, partial [Citrus clementina] gi|557532401|gb|ESR43584.1| hypothetical protein CICLE_v100109402mg, partial [Citrus clementina] Length = 759 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 + GFEPKERCMLLKFVTSCSRAPLLGFKHLQP+FTIHKV Sbjct: 665 VEGFEPKERCMLLKFVTSCSRAPLLGFKHLQPSFTIHKV 703 >gb|EXB75953.1| E3 ubiquitin-protein ligase UPL7 [Morus notabilis] Length = 1167 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I GF+PKERCMLLKFVTSCSR PLLGFKHLQPTFTIHKV Sbjct: 1073 IKGFQPKERCMLLKFVTSCSRPPLLGFKHLQPTFTIHKV 1111 >ref|XP_006366787.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Solanum tuberosum] Length = 1160 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 306 AGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 A FEPKERC+LLKFVTSCSRAPLLGFKHLQPTFTIHKV Sbjct: 1067 ASFEPKERCLLLKFVTSCSRAPLLGFKHLQPTFTIHKV 1104 >ref|XP_002322903.2| hypothetical protein POPTR_0016s10980g [Populus trichocarpa] gi|550321241|gb|EEF04664.2| hypothetical protein POPTR_0016s10980g [Populus trichocarpa] Length = 1173 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I GFEP ERCMLLKFVTSCSRAPLLGFKHLQP+FTIHKV Sbjct: 1079 IKGFEPNERCMLLKFVTSCSRAPLLGFKHLQPSFTIHKV 1117 >ref|XP_002528627.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223531916|gb|EEF33730.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1148 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I GFEP ERCMLLKFVTSCSRAPLLGFKHLQP+FTIHKV Sbjct: 1074 IKGFEPNERCMLLKFVTSCSRAPLLGFKHLQPSFTIHKV 1112 >ref|XP_003553574.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Glycine max] gi|571558707|ref|XP_006604604.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X2 [Glycine max] gi|571558711|ref|XP_006604605.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X3 [Glycine max] gi|571558715|ref|XP_006604606.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X4 [Glycine max] Length = 1157 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I GFEPKERCMLLKFVTSCSRAPLLGFK+LQP FTIHKV Sbjct: 1063 IKGFEPKERCMLLKFVTSCSRAPLLGFKYLQPPFTIHKV 1101 >gb|AEJ54425.1| ubiquitin-protein ligase UPL7 [Fagopyrum esculentum subsp. ancestrale] Length = 72 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 +AG EPKERC+LLKFVTSCSRAPLLGFKHL PTFTIHKV Sbjct: 13 MAGIEPKERCLLLKFVTSCSRAPLLGFKHLHPTFTIHKV 51 >ref|XP_007204674.1| hypothetical protein PRUPE_ppa000451mg [Prunus persica] gi|462400205|gb|EMJ05873.1| hypothetical protein PRUPE_ppa000451mg [Prunus persica] Length = 1167 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 + GFEP ERCMLLKFVTSCSRAPLLGFKHLQP FTIHKV Sbjct: 1073 LKGFEPSERCMLLKFVTSCSRAPLLGFKHLQPMFTIHKV 1111 >gb|EPS71373.1| ubiquitin-protein ligase 7, partial [Genlisea aurea] Length = 1145 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 306 AGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 AGFEPKERCM+LKFVTSCSRAPLLGF+HL P+FTIHKV Sbjct: 1052 AGFEPKERCMVLKFVTSCSRAPLLGFRHLHPSFTIHKV 1089 >ref|XP_004246588.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like [Solanum lycopersicum] Length = 1160 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 306 AGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 A FEPKERC+LLKFVTSCSRAPLLGFK+LQPTFTIHKV Sbjct: 1067 ASFEPKERCLLLKFVTSCSRAPLLGFKYLQPTFTIHKV 1104 >ref|XP_004494118.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Cicer arietinum] gi|502111639|ref|XP_004494119.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X2 [Cicer arietinum] Length = 1162 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKV 193 I GFEPKERCM+LKFVTSCSRAPLLGFK+LQP FTIHKV Sbjct: 1068 IKGFEPKERCMVLKFVTSCSRAPLLGFKYLQPPFTIHKV 1106 >gb|ADE75928.1| unknown [Picea sitchensis] Length = 300 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKVQSYTVL 175 + G EP+ERC LLKFVTSCSRAPLLGFKHLQPTFTIHKV T L Sbjct: 206 VRGLEPEERCTLLKFVTSCSRAPLLGFKHLQPTFTIHKVACDTPL 250 >ref|XP_006403726.1| hypothetical protein EUTSA_v10010078mg [Eutrema salsugineum] gi|557104845|gb|ESQ45179.1| hypothetical protein EUTSA_v10010078mg [Eutrema salsugineum] Length = 1143 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -3 Query: 303 GFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKVQSYTVL 175 GFEP ERCMLLKFVTSCSRAPLLGFK+LQPTF IHKV T L Sbjct: 1051 GFEPSERCMLLKFVTSCSRAPLLGFKYLQPTFIIHKVSCDTSL 1093 >ref|XP_007027557.1| E3 ubiquitin-protein ligase UPL7 isoform 6 [Theobroma cacao] gi|508716162|gb|EOY08059.1| E3 ubiquitin-protein ligase UPL7 isoform 6 [Theobroma cacao] Length = 1038 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 309 IAGFEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKVQS 187 + FEPKERCMLLKFVTSCSRAPLLGFK LQP+FTIHKV S Sbjct: 944 VKDFEPKERCMLLKFVTSCSRAPLLGFKFLQPSFTIHKVAS 984 >ref|XP_007027554.1| E3 ubiquitin-protein ligase UPL7 isoform 3, partial [Theobroma cacao] gi|508716159|gb|EOY08056.1| E3 ubiquitin-protein ligase UPL7 isoform 3, partial [Theobroma cacao] Length = 1147 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 300 FEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKVQS 187 FEPKERCMLLKFVTSCSRAPLLGFK LQP+FTIHKV S Sbjct: 1074 FEPKERCMLLKFVTSCSRAPLLGFKFLQPSFTIHKVAS 1111 >ref|XP_007027553.1| E3 ubiquitin-protein ligase UPL7 isoform 2 [Theobroma cacao] gi|508716158|gb|EOY08055.1| E3 ubiquitin-protein ligase UPL7 isoform 2 [Theobroma cacao] Length = 1143 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 300 FEPKERCMLLKFVTSCSRAPLLGFKHLQPTFTIHKVQS 187 FEPKERCMLLKFVTSCSRAPLLGFK LQP+FTIHKV S Sbjct: 1074 FEPKERCMLLKFVTSCSRAPLLGFKFLQPSFTIHKVAS 1111