BLASTX nr result
ID: Akebia27_contig00018560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00018560 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214419.1| hypothetical protein PRUPE_ppa026042mg [Prun... 70 2e-10 gb|EXB36074.1| Calcium-activated outward-rectifying potassium ch... 58 2e-06 ref|XP_006474903.1| PREDICTED: two-pore potassium channel 1-like... 57 3e-06 ref|XP_002264798.1| PREDICTED: calcium-activated outward-rectify... 55 8e-06 >ref|XP_007214419.1| hypothetical protein PRUPE_ppa026042mg [Prunus persica] gi|462410284|gb|EMJ15618.1| hypothetical protein PRUPE_ppa026042mg [Prunus persica] Length = 354 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = +3 Query: 117 DAKVPLLSGLLDPSPQSNQKNTIKRRRYRRCRSAPI-EFIPLEKKDDVLPPPTESIFAKV 293 D + P++S L DPSPQ+NQKN +K R YRRC+SAP+ E++PL+ D P TESI + Sbjct: 5 DVREPMISALGDPSPQTNQKNPMKSRTYRRCKSAPLAEYVPLKTTDTGSVPVTESILQNL 64 Query: 294 NPSFTR 311 P+F + Sbjct: 65 RPNFQK 70 >gb|EXB36074.1| Calcium-activated outward-rectifying potassium channel 1 [Morus notabilis] Length = 355 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +3 Query: 117 DAKVPLLSGLLDPSPQSNQKNTIKRRRYRRCRSAPI-EFIPLEKKDDVLPPPTESIFAKV 293 D + PLLSG D +PQ+ K+T KR+R+RR +SAP+ +F+P EK P + +IF + Sbjct: 5 DVRQPLLSGRTDLNPQTRSKDTPKRKRFRRSKSAPLADFVPFEKTSIGSDPQSNAIFGNI 64 Query: 294 NPSFTR 311 +P+ + Sbjct: 65 HPNICK 70 >ref|XP_006474903.1| PREDICTED: two-pore potassium channel 1-like isoform X1 [Citrus sinensis] gi|568841922|ref|XP_006474904.1| PREDICTED: two-pore potassium channel 1-like isoform X2 [Citrus sinensis] gi|568841924|ref|XP_006474905.1| PREDICTED: two-pore potassium channel 1-like isoform X3 [Citrus sinensis] gi|568841926|ref|XP_006474906.1| PREDICTED: two-pore potassium channel 1-like isoform X4 [Citrus sinensis] Length = 354 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = +3 Query: 120 AKVPLLSGLLDPSPQSNQKNTIKRRRYRRCRSAP---IEFIPLEKKDDVLPPPTESIFAK 290 A PLLSG +D +PQ+N K+ KRRR RRCRSAP + + + +KD +ES+F K Sbjct: 6 ANQPLLSGFVDSTPQTNNKDAPKRRRLRRCRSAPQTDVAALDINEKDST--HLSESLFGK 63 Query: 291 VNPSFTR 311 P+F R Sbjct: 64 PRPNFKR 70 >ref|XP_002264798.1| PREDICTED: calcium-activated outward-rectifying potassium channel 1 [Vitis vinifera] gi|296089904|emb|CBI39723.3| unnamed protein product [Vitis vinifera] Length = 350 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +3 Query: 111 NGDAKVPLLSGLLDPSPQSNQKNTIKRRRYRRCRSAPI 224 +G A P + GLL+PSPQ+NQK ++KR+RYRRCRSAP+ Sbjct: 3 HGAAAKPSVLGLLNPSPQTNQKASLKRKRYRRCRSAPV 40