BLASTX nr result
ID: Akebia27_contig00018535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00018535 (535 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147505.1| PREDICTED: carbonic anhydrase 2, chloroplast... 73 5e-11 ref|XP_004290413.1| PREDICTED: carbonic anhydrase, chloroplastic... 67 2e-09 ref|XP_006487507.1| PREDICTED: carbonic anhydrase 1-like isoform... 67 3e-09 ref|XP_006487506.1| PREDICTED: carbonic anhydrase 1-like isoform... 67 3e-09 ref|XP_006433840.1| hypothetical protein CICLE_v10001873mg [Citr... 67 3e-09 ref|XP_006433839.1| hypothetical protein CICLE_v10001873mg [Citr... 67 3e-09 ref|XP_006433838.1| hypothetical protein CICLE_v10001873mg [Citr... 67 3e-09 ref|XP_006423763.1| hypothetical protein CICLE_v10028905mg [Citr... 67 3e-09 ref|XP_006423761.1| hypothetical protein CICLE_v10028905mg [Citr... 67 3e-09 ref|XP_006423760.1| hypothetical protein CICLE_v10028905mg [Citr... 67 3e-09 ref|XP_007200444.1| hypothetical protein PRUPE_ppa008903mg [Prun... 67 4e-09 gb|EYU18430.1| hypothetical protein MIMGU_mgv1a010730mg [Mimulus... 66 5e-09 ref|XP_006472484.1| PREDICTED: carbonic anhydrase, chloroplastic... 65 1e-08 ref|XP_006472483.1| PREDICTED: carbonic anhydrase, chloroplastic... 65 1e-08 ref|XP_006472482.1| PREDICTED: carbonic anhydrase, chloroplastic... 65 1e-08 ref|XP_003631728.1| PREDICTED: carbonic anhydrase 2, chloroplast... 65 1e-08 ref|XP_002263870.2| PREDICTED: carbonic anhydrase 2, chloroplast... 65 1e-08 emb|CBI34003.3| unnamed protein product [Vitis vinifera] 65 1e-08 emb|CAN64241.1| hypothetical protein VITISV_005703 [Vitis vinifera] 65 1e-08 emb|CBI19256.3| unnamed protein product [Vitis vinifera] 65 1e-08 >ref|XP_004147505.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like [Cucumis sativus] gi|449527019|ref|XP_004170510.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like [Cucumis sativus] Length = 300 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V KG L IHGGYYDFV+CTFEKWTLDY+ SN N E+ A K REFWS Sbjct: 253 VKKGNLSIHGGYYDFVDCTFEKWTLDYEASNFN--EETRRLAVKNREFWS 300 >ref|XP_004290413.1| PREDICTED: carbonic anhydrase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 295 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V KG+L IHGGYYDFV+CTFEKWTLDYK N++EK+ + K WS Sbjct: 248 VKKGILSIHGGYYDFVDCTFEKWTLDYK--EDNLKEKNGRVSVKNHLLWS 295 >ref|XP_006487507.1| PREDICTED: carbonic anhydrase 1-like isoform X2 [Citrus sinensis] Length = 305 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V G L +HGGYY+FV+CTFEKWTLDY G SN++E E+ AF+ R FWS Sbjct: 259 VRAGALSLHGGYYNFVDCTFEKWTLDYDG--SNLKESKEV-AFRNRSFWS 305 >ref|XP_006487506.1| PREDICTED: carbonic anhydrase 1-like isoform X1 [Citrus sinensis] Length = 307 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V G L +HGGYY+FV+CTFEKWTLDY G SN++E E+ AF+ R FWS Sbjct: 261 VRAGALSLHGGYYNFVDCTFEKWTLDYDG--SNLKESKEV-AFRNRSFWS 307 >ref|XP_006433840.1| hypothetical protein CICLE_v10001873mg [Citrus clementina] gi|557535962|gb|ESR47080.1| hypothetical protein CICLE_v10001873mg [Citrus clementina] Length = 318 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V K LL IHGGYYD +NCTFEKWTLDYKGS + EE+ ++ K FWS Sbjct: 270 VRKELLFIHGGYYDLLNCTFEKWTLDYKGSKVD-EEEVGRHSIKDHSFWS 318 >ref|XP_006433839.1| hypothetical protein CICLE_v10001873mg [Citrus clementina] gi|557535961|gb|ESR47079.1| hypothetical protein CICLE_v10001873mg [Citrus clementina] Length = 290 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V K LL IHGGYYD +NCTFEKWTLDYKGS + EE+ ++ K FWS Sbjct: 242 VRKELLFIHGGYYDLLNCTFEKWTLDYKGSKVD-EEEVGRHSIKDHSFWS 290 >ref|XP_006433838.1| hypothetical protein CICLE_v10001873mg [Citrus clementina] gi|557535960|gb|ESR47078.1| hypothetical protein CICLE_v10001873mg [Citrus clementina] Length = 280 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V K LL IHGGYYD +NCTFEKWTLDYKGS + EE+ ++ K FWS Sbjct: 232 VRKELLFIHGGYYDLLNCTFEKWTLDYKGSKVD-EEEVGRHSIKDHSFWS 280 >ref|XP_006423763.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] gi|557525697|gb|ESR37003.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] Length = 307 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V G L +HGGYY+FV+CTFEKWTLDY G SN++E E+ AF+ R FWS Sbjct: 261 VRAGALSLHGGYYNFVDCTFEKWTLDYDG--SNLKESKEV-AFRNRSFWS 307 >ref|XP_006423761.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] gi|557525695|gb|ESR37001.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] Length = 306 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V G L +HGGYY+FV+CTFEKWTLDY G SN++E E+ AF+ R FWS Sbjct: 260 VRAGALSLHGGYYNFVDCTFEKWTLDYDG--SNLKESKEV-AFRNRSFWS 306 >ref|XP_006423760.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] gi|567862216|ref|XP_006423762.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] gi|557525694|gb|ESR37000.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] gi|557525696|gb|ESR37002.1| hypothetical protein CICLE_v10028905mg [Citrus clementina] Length = 214 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V G L +HGGYY+FV+CTFEKWTLDY G SN++E E+ AF+ R FWS Sbjct: 168 VRAGALSLHGGYYNFVDCTFEKWTLDYDG--SNLKESKEV-AFRNRSFWS 214 >ref|XP_007200444.1| hypothetical protein PRUPE_ppa008903mg [Prunus persica] gi|462395844|gb|EMJ01643.1| hypothetical protein PRUPE_ppa008903mg [Prunus persica] Length = 315 Score = 66.6 bits (161), Expect = 4e-09 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V G+L +HGGYYDFV+CTFEKWTLDYK N++EK + K FWS Sbjct: 268 VKNGILSVHGGYYDFVDCTFEKWTLDYK--EDNLKEKHGRISVKNHLFWS 315 >gb|EYU18430.1| hypothetical protein MIMGU_mgv1a010730mg [Mimulus guttatus] Length = 303 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V +G L IHGGYYDF++CTFEKWTLDYKG+ + D + K REFW+ Sbjct: 257 VVRGKLSIHGGYYDFIDCTFEKWTLDYKGTTMH---GDSECSIKNREFWT 303 >ref|XP_006472484.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 [Citrus sinensis] Length = 290 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V K LL IHGGYYD +NCTFEKWTLDYKG + EE+ ++ K FWS Sbjct: 242 VRKELLFIHGGYYDLLNCTFEKWTLDYKGRKVD-EEEVGRHSIKDHSFWS 290 >ref|XP_006472483.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 [Citrus sinensis] Length = 306 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V K LL IHGGYYD +NCTFEKWTLDYKG + EE+ ++ K FWS Sbjct: 258 VRKELLFIHGGYYDLLNCTFEKWTLDYKGRKVD-EEEVGRHSIKDHSFWS 306 >ref|XP_006472482.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 [Citrus sinensis] Length = 318 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V K LL IHGGYYD +NCTFEKWTLDYKG + EE+ ++ K FWS Sbjct: 270 VRKELLFIHGGYYDLLNCTFEKWTLDYKGRKVD-EEEVGRHSIKDHSFWS 318 >ref|XP_003631728.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like isoform 2 [Vitis vinifera] Length = 262 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V +G+L IHGGYYDFVNCTFEKWTLDYK S Y K R FW+ Sbjct: 221 VERGMLSIHGGYYDFVNCTFEKWTLDYKESG--------RYLVKDRVFWA 262 >ref|XP_002263870.2| PREDICTED: carbonic anhydrase 2, chloroplastic-like isoform 1 [Vitis vinifera] Length = 300 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V +G+L IHGGYYDFVNCTFEKWTLDYK S Y K R FW+ Sbjct: 259 VERGMLSIHGGYYDFVNCTFEKWTLDYKESG--------RYLVKDRVFWA 300 >emb|CBI34003.3| unnamed protein product [Vitis vinifera] Length = 301 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V +G+L IHGGYYDFVNCTFEKWTLDYK S Y K R FW+ Sbjct: 260 VERGMLSIHGGYYDFVNCTFEKWTLDYKESG--------RYLVKDRVFWA 301 >emb|CAN64241.1| hypothetical protein VITISV_005703 [Vitis vinifera] Length = 211 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -2 Query: 534 VSKGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFWS 385 V +G+L IHGGYYDFVNCTFEKWTLDYK S Y K R FW+ Sbjct: 170 VERGMLSIHGGYYDFVNCTFEKWTLDYKESG--------RYLVKDRVFWA 211 >emb|CBI19256.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 528 KGLLHIHGGYYDFVNCTFEKWTLDYKGSNSNMEEKDEMYAFKGREFW 388 KGLL IHGGYYDF+NCTFEKWT+D+K S++E++ K R FW Sbjct: 283 KGLLSIHGGYYDFLNCTFEKWTIDFK--RSSIEKEGPKCLVKNRAFW 327