BLASTX nr result
ID: Akebia27_contig00018293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00018293 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845889.1| hypothetical protein AMTR_s00154p00087720 [A... 68 2e-09 ref|XP_002265916.2| PREDICTED: uncharacterized protein LOC100241... 68 2e-09 ref|XP_007200439.1| hypothetical protein PRUPE_ppa012787mg [Prun... 67 3e-09 ref|XP_002321368.1| hypothetical protein POPTR_0015s00800g [Popu... 67 3e-09 gb|EXB55295.1| hypothetical protein L484_017206 [Morus notabilis] 66 6e-09 ref|XP_006487654.1| PREDICTED: tropomyosin-like isoform X1 [Citr... 66 6e-09 ref|XP_006423898.1| hypothetical protein CICLE_v10029442mg [Citr... 66 6e-09 ref|XP_002317807.2| hypothetical protein POPTR_0012s02910g [Popu... 66 6e-09 ref|XP_002530267.1| conserved hypothetical protein [Ricinus comm... 66 6e-09 ref|XP_004230636.1| PREDICTED: uncharacterized protein LOC101245... 65 7e-09 ref|XP_004504787.1| PREDICTED: uncharacterized protein LOC101494... 65 1e-08 ref|XP_007042974.1| Dbj:BAA96220.1 [Theobroma cacao] gi|50870690... 65 1e-08 dbj|BAJ89520.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 1e-08 ref|XP_003524738.2| PREDICTED: uncharacterized protein LOC100804... 64 2e-08 ref|XP_007159096.1| hypothetical protein PHAVU_002G208400g [Phas... 64 2e-08 ref|XP_003531035.1| PREDICTED: uncharacterized protein LOC100779... 64 2e-08 ref|XP_006394188.1| hypothetical protein EUTSA_v10005060mg [Eutr... 64 3e-08 ref|XP_006281242.1| hypothetical protein CARUB_v10027285mg [Caps... 64 3e-08 ref|NP_201223.1| uncharacterized protein [Arabidopsis thaliana] ... 64 3e-08 gb|AAM62887.1| unknown [Arabidopsis thaliana] 64 3e-08 >ref|XP_006845889.1| hypothetical protein AMTR_s00154p00087720 [Amborella trichopoda] gi|548848533|gb|ERN07564.1| hypothetical protein AMTR_s00154p00087720 [Amborella trichopoda] Length = 156 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VFKLHMEELR KQEEISKRDS+IKVLEAIIQTL GKE Sbjct: 117 VFKLHMEELRLKQEEISKRDSDIKVLEAIIQTLGGKE 153 >ref|XP_002265916.2| PREDICTED: uncharacterized protein LOC100241703 [Vitis vinifera] gi|296085678|emb|CBI29477.3| unnamed protein product [Vitis vinifera] Length = 156 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKESPTA 217 VF+LHMEELRAKQ+EI+KRDS+IKVLEAIIQTL GKES ++ Sbjct: 112 VFELHMEELRAKQQEIAKRDSDIKVLEAIIQTLGGKESSSS 152 >ref|XP_007200439.1| hypothetical protein PRUPE_ppa012787mg [Prunus persica] gi|462395839|gb|EMJ01638.1| hypothetical protein PRUPE_ppa012787mg [Prunus persica] Length = 154 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEI+KRD EIK+LEAIIQTL GKES Sbjct: 112 VFELHMEELRAKQEEIAKRDKEIKLLEAIIQTLGGKES 149 >ref|XP_002321368.1| hypothetical protein POPTR_0015s00800g [Populus trichocarpa] gi|222868364|gb|EEF05495.1| hypothetical protein POPTR_0015s00800g [Populus trichocarpa] Length = 159 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEISKR+S+IK+LEAIIQTL GKES Sbjct: 117 VFELHMEELRAKQEEISKRESDIKLLEAIIQTLGGKES 154 >gb|EXB55295.1| hypothetical protein L484_017206 [Morus notabilis] Length = 154 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEISKRD EIK+LEAIIQTL G ES Sbjct: 112 VFELHMEELRAKQEEISKRDKEIKLLEAIIQTLGGTES 149 >ref|XP_006487654.1| PREDICTED: tropomyosin-like isoform X1 [Citrus sinensis] Length = 162 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEISKRD EIK+LEAIIQTL KES Sbjct: 120 VFELHMEELRAKQEEISKRDKEIKLLEAIIQTLGAKES 157 >ref|XP_006423898.1| hypothetical protein CICLE_v10029442mg [Citrus clementina] gi|557525832|gb|ESR37138.1| hypothetical protein CICLE_v10029442mg [Citrus clementina] Length = 162 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEISKRD EIK+LEAIIQTL KES Sbjct: 120 VFELHMEELRAKQEEISKRDKEIKLLEAIIQTLGAKES 157 >ref|XP_002317807.2| hypothetical protein POPTR_0012s02910g [Populus trichocarpa] gi|550326259|gb|EEE96027.2| hypothetical protein POPTR_0012s02910g [Populus trichocarpa] Length = 217 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQ+EISKRD +IK+LEAIIQTL GKES Sbjct: 175 VFELHMEELRAKQDEISKRDGDIKLLEAIIQTLGGKES 212 >ref|XP_002530267.1| conserved hypothetical protein [Ricinus communis] gi|223530199|gb|EEF32107.1| conserved hypothetical protein [Ricinus communis] Length = 154 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VF+LHMEELRAKQ+EISKRD+EIK+LEAIIQTL GKE Sbjct: 112 VFELHMEELRAKQDEISKRDNEIKLLEAIIQTLGGKE 148 >ref|XP_004230636.1| PREDICTED: uncharacterized protein LOC101245002 [Solanum lycopersicum] Length = 155 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEISKRD EIK+LEAIIQTL GK S Sbjct: 113 VFELHMEELRAKQEEISKRDKEIKLLEAIIQTLGGKGS 150 >ref|XP_004504787.1| PREDICTED: uncharacterized protein LOC101494197 [Cicer arietinum] Length = 153 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELR+KQEEI+KRD++IK+LEAIIQTL GKES Sbjct: 111 VFELHMEELRSKQEEITKRDNDIKLLEAIIQTLGGKES 148 >ref|XP_007042974.1| Dbj:BAA96220.1 [Theobroma cacao] gi|508706909|gb|EOX98805.1| Dbj:BAA96220.1 [Theobroma cacao] Length = 156 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LH EELRAKQEEISKRD EIK+LEAIIQTL GK+S Sbjct: 114 VFELHTEELRAKQEEISKRDKEIKLLEAIIQTLGGKDS 151 >dbj|BAJ89520.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 171 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VF+LHMEELRAKQEEI+KRDS+IKVLEAII+TLS KE Sbjct: 129 VFQLHMEELRAKQEEIAKRDSDIKVLEAIIRTLSSKE 165 >ref|XP_003524738.2| PREDICTED: uncharacterized protein LOC100804902 isoform 1 [Glycine max] Length = 166 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEI KRD +IK+LEAII+TL GKES Sbjct: 124 VFELHMEELRAKQEEIEKRDEDIKLLEAIIRTLGGKES 161 >ref|XP_007159096.1| hypothetical protein PHAVU_002G208400g [Phaseolus vulgaris] gi|561032511|gb|ESW31090.1| hypothetical protein PHAVU_002G208400g [Phaseolus vulgaris] Length = 171 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEI KRD +IK+LEAII+TL GKES Sbjct: 129 VFELHMEELRAKQEEIEKRDEDIKLLEAIIRTLGGKES 166 >ref|XP_003531035.1| PREDICTED: uncharacterized protein LOC100779456 [Glycine max] Length = 159 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKES 226 VF+LHMEELRAKQEEI KRD +IK+LEAII+TL GKES Sbjct: 117 VFELHMEELRAKQEEIEKRDEDIKLLEAIIRTLGGKES 154 >ref|XP_006394188.1| hypothetical protein EUTSA_v10005060mg [Eutrema salsugineum] gi|557090827|gb|ESQ31474.1| hypothetical protein EUTSA_v10005060mg [Eutrema salsugineum] Length = 158 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VFKLHMEELR QE+ISKRD+EIK+LEAIIQTL GKE Sbjct: 113 VFKLHMEELRGMQEQISKRDNEIKLLEAIIQTLGGKE 149 >ref|XP_006281242.1| hypothetical protein CARUB_v10027285mg [Capsella rubella] gi|482549946|gb|EOA14140.1| hypothetical protein CARUB_v10027285mg [Capsella rubella] Length = 158 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VFKLHMEELR QE+ISKRD+EIK+LEAIIQTL GKE Sbjct: 113 VFKLHMEELRGMQEQISKRDNEIKLLEAIIQTLGGKE 149 >ref|NP_201223.1| uncharacterized protein [Arabidopsis thaliana] gi|9759394|dbj|BAB09849.1| unnamed protein product [Arabidopsis thaliana] gi|15810363|gb|AAL07069.1| unknown protein [Arabidopsis thaliana] gi|21280975|gb|AAM45070.1| unknown protein [Arabidopsis thaliana] gi|332010468|gb|AED97851.1| uncharacterized protein AT5G64180 [Arabidopsis thaliana] Length = 158 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VFKLHMEELR QE+ISKRD+EIK+LEAIIQTL GKE Sbjct: 113 VFKLHMEELRGMQEQISKRDNEIKLLEAIIQTLGGKE 149 >gb|AAM62887.1| unknown [Arabidopsis thaliana] Length = 158 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 339 VFKLHMEELRAKQEEISKRDSEIKVLEAIIQTLSGKE 229 VFKLHMEELR QE+ISKRD+EIK+LEAIIQTL GKE Sbjct: 113 VFKLHMEELRGMQEQISKRDNEIKLLEAIIQTLGGKE 149