BLASTX nr result
ID: Akebia27_contig00017664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00017664 (715 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT16132.1| hypothetical protein F775_03544 [Aegilops tauschii] 51 2e-06 >gb|EMT16132.1| hypothetical protein F775_03544 [Aegilops tauschii] Length = 1062 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 24/46 (52%), Positives = 31/46 (67%) Frame = +2 Query: 401 HRI*AG*IKCQCASGAKYDRLHPNQI*MKFYKMAARQAMFYIAECW 538 HRI AG +KC+ ASG D+ P ++ KFY+MA AM Y+AECW Sbjct: 202 HRIKAGWMKCRQASGILCDKRVPQKLKGKFYRMAVPPAMLYVAECW 247 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 564 VGPSLIDDKLGES*LSWFAHVQWRMITVPV 653 VG + I++KL + L WF H+Q R PV Sbjct: 286 VGVAPIEEKLVQYRLRWFGHIQRRPPEAPV 315