BLASTX nr result
ID: Akebia27_contig00017404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00017404 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25930.3| unnamed protein product [Vitis vinifera] 74 2e-11 gb|EXC17879.1| Primary amine oxidase [Morus notabilis] 72 6e-11 ref|XP_006477269.1| PREDICTED: primary amine oxidase-like [Citru... 72 6e-11 ref|XP_006440400.1| hypothetical protein CICLE_v10019032mg [Citr... 72 6e-11 ref|XP_002299418.2| hypothetical protein POPTR_0001s07870g [Popu... 72 6e-11 ref|XP_007039969.1| Copper amine oxidase family protein [Theobro... 72 6e-11 ref|XP_007099697.1| Copper amine oxidase family protein [Theobro... 72 6e-11 gb|EPS58276.1| hypothetical protein M569_16538, partial [Genlise... 71 1e-10 ref|XP_002872650.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp... 71 1e-10 ref|XP_002509596.1| Amine oxidase [copper-containing] precursor,... 71 1e-10 ref|XP_006287136.1| hypothetical protein CARUB_v10000307mg [Caps... 70 4e-10 gb|AAD49420.1|AF172681_1 amine oxidase [Canavalia lineata] 70 4e-10 gb|AET97662.2| copper amine oxidase [Camellia sinensis] 70 4e-10 emb|CBI34761.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002275872.1| PREDICTED: primary amine oxidase [Vitis vini... 70 4e-10 ref|NP_192965.1| copper amine oxidase family protein [Arabidopsi... 70 4e-10 ref|XP_004298687.1| PREDICTED: primary amine oxidase-like [Fraga... 69 7e-10 ref|NP_192966.5| copper amine oxidase family protein [Arabidopsi... 69 7e-10 gb|ADQ37305.1| putative copper-containing diamine oxidase [Pinus... 69 7e-10 emb|CAB45976.1| copper amine oxidase-like protein [Arabidopsis t... 69 7e-10 >emb|CBI25930.3| unnamed protein product [Vitis vinifera] Length = 116 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NP+LRAAPN EKDLPVC+ Sbjct: 74 PIMPTVSSSFDLKPVNFFESNPVLRAAPNFEKDLPVCR 111 >gb|EXC17879.1| Primary amine oxidase [Morus notabilis] Length = 730 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVCK Sbjct: 688 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK 725 >ref|XP_006477269.1| PREDICTED: primary amine oxidase-like [Citrus sinensis] Length = 731 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVCK Sbjct: 689 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK 726 >ref|XP_006440400.1| hypothetical protein CICLE_v10019032mg [Citrus clementina] gi|557542662|gb|ESR53640.1| hypothetical protein CICLE_v10019032mg [Citrus clementina] Length = 731 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVCK Sbjct: 689 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK 726 >ref|XP_002299418.2| hypothetical protein POPTR_0001s07870g [Populus trichocarpa] gi|550346782|gb|EEE84223.2| hypothetical protein POPTR_0001s07870g [Populus trichocarpa] Length = 738 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVCK Sbjct: 696 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK 733 >ref|XP_007039969.1| Copper amine oxidase family protein [Theobroma cacao] gi|508777214|gb|EOY24470.1| Copper amine oxidase family protein [Theobroma cacao] Length = 734 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVCK Sbjct: 692 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK 729 >ref|XP_007099697.1| Copper amine oxidase family protein [Theobroma cacao] gi|508728435|gb|EOY20332.1| Copper amine oxidase family protein [Theobroma cacao] Length = 90 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVCK Sbjct: 48 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCK 85 >gb|EPS58276.1| hypothetical protein M569_16538, partial [Genlisea aurea] Length = 587 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVC+ Sbjct: 545 PIMPTVSSSFDLKPVNFFERNPILRIPPNVEKDLPVCR 582 >ref|XP_002872650.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp. lyrata] gi|297318487|gb|EFH48909.1| AT4g12290/T4C9_130 [Arabidopsis lyrata subsp. lyrata] Length = 751 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKPVNFF+ NPILRAAPN E DLPVC Sbjct: 708 PIMPTVSSSFDLKPVNFFERNPILRAAPNFEHDLPVC 744 >ref|XP_002509596.1| Amine oxidase [copper-containing] precursor, putative [Ricinus communis] gi|223549495|gb|EEF50983.1| Amine oxidase [copper-containing] precursor, putative [Ricinus communis] Length = 730 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLPVC+ Sbjct: 688 PIMPTVSSSFDLKPVNFFESNPILRIPPNVEKDLPVCR 725 >ref|XP_006287136.1| hypothetical protein CARUB_v10000307mg [Capsella rubella] gi|482555842|gb|EOA20034.1| hypothetical protein CARUB_v10000307mg [Capsella rubella] Length = 738 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKP NFF+ NPILRAAPN E DLPVC Sbjct: 695 PIMPTVSSSFDLKPTNFFERNPILRAAPNYEHDLPVC 731 >gb|AAD49420.1|AF172681_1 amine oxidase [Canavalia lineata] Length = 735 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN E DLPVCK Sbjct: 693 PIMPTVSSSFDLKPVNFFERNPILRVPPNFEDDLPVCK 730 >gb|AET97662.2| copper amine oxidase [Camellia sinensis] Length = 173 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 PIMPTVSSSFDLKPVNFF+ NPILR PN EKDLP CK Sbjct: 131 PIMPTVSSSFDLKPVNFFENNPILRIPPNVEKDLPNCK 168 >emb|CBI34761.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 P+MPTVSSSFDLKPVNFF+ NPILR PN E DLP+CK Sbjct: 594 PVMPTVSSSFDLKPVNFFESNPILRMPPNVENDLPICK 631 >ref|XP_002275872.1| PREDICTED: primary amine oxidase [Vitis vinifera] Length = 727 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVCK 251 P+MPTVSSSFDLKPVNFF+ NPILR PN E DLP+CK Sbjct: 685 PVMPTVSSSFDLKPVNFFESNPILRMPPNVENDLPICK 722 >ref|NP_192965.1| copper amine oxidase family protein [Arabidopsis thaliana] gi|5281039|emb|CAB45975.1| copper amine oxidase like protein (fragment2) [Arabidopsis thaliana] gi|7267929|emb|CAB78271.1| copper amine oxidase like protein (fragment2) [Arabidopsis thaliana] gi|332657710|gb|AEE83110.1| copper amine oxidase family protein [Arabidopsis thaliana] Length = 300 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKPVNFF+ NPIL+AAPN E DLPVC Sbjct: 257 PIMPTVSSSFDLKPVNFFERNPILKAAPNFEYDLPVC 293 >ref|XP_004298687.1| PREDICTED: primary amine oxidase-like [Fragaria vesca subsp. vesca] Length = 732 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKPVNFF+ NPILR PN E DLPVC Sbjct: 690 PIMPTVSSSFDLKPVNFFERNPILRTPPNVESDLPVC 726 >ref|NP_192966.5| copper amine oxidase family protein [Arabidopsis thaliana] gi|22654995|gb|AAM98089.1| AT4g12290/T4C9_130 [Arabidopsis thaliana] gi|28416507|gb|AAO42784.1| AT4g12290/T4C9_130 [Arabidopsis thaliana] gi|332657711|gb|AEE83111.1| copper amine oxidase family protein [Arabidopsis thaliana] Length = 741 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKPVNFF+ NPIL AAPN E DLPVC Sbjct: 698 PIMPTVSSSFDLKPVNFFERNPILSAAPNFEHDLPVC 734 >gb|ADQ37305.1| putative copper-containing diamine oxidase [Pinus sylvestris] Length = 729 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKP NFF+ NPILR APN EKDLP C Sbjct: 688 PIMPTVSSSFDLKPTNFFESNPILRTAPNYEKDLPTC 724 >emb|CAB45976.1| copper amine oxidase-like protein [Arabidopsis thaliana] gi|7267930|emb|CAB78272.1| copper amine oxidase-like protein [Arabidopsis thaliana] Length = 756 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 364 PIMPTVSSSFDLKPVNFFDYNPILRAAPNTEKDLPVC 254 PIMPTVSSSFDLKPVNFF+ NPIL AAPN E DLPVC Sbjct: 713 PIMPTVSSSFDLKPVNFFERNPILSAAPNFEHDLPVC 749