BLASTX nr result
ID: Akebia27_contig00017346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00017346 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510238.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_006374952.1| hypothetical protein POPTR_0014s03040g [Popu... 58 1e-06 ref|XP_007017283.1| Calmodulin like 37, putative [Theobroma caca... 57 4e-06 >ref|XP_002510238.1| conserved hypothetical protein [Ricinus communis] gi|223550939|gb|EEF52425.1| conserved hypothetical protein [Ricinus communis] Length = 95 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -3 Query: 374 ELKEALKRNGVWFTSIRSKHYVRSADNNGNGRIEDCEIGNLVEIAKK-LNVKIVT 213 EL EA++ NG WF + K V+SAD+NGNG ++ EI NLVE AKK L VKIV+ Sbjct: 41 ELAEAIRENGGWFARWKGKRGVKSADSNGNGFVDANEISNLVEFAKKHLGVKIVS 95 >ref|XP_006374952.1| hypothetical protein POPTR_0014s03040g [Populus trichocarpa] gi|550323265|gb|ERP52749.1| hypothetical protein POPTR_0014s03040g [Populus trichocarpa] Length = 93 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/54 (51%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 374 ELKEALKRNGVWFTSIRSKHYVRSADNNGNGRIEDCEIGNLVEIAKK-LNVKIV 216 EL +A++ NG WF ++K V SAD+NGNG +++ EIGNLVE A+K L +KI+ Sbjct: 40 ELSDAVRGNGGWFAGWKAKRGVGSADSNGNGFVDESEIGNLVEFAQKHLGIKII 93 >ref|XP_007017283.1| Calmodulin like 37, putative [Theobroma cacao] gi|508722611|gb|EOY14508.1| Calmodulin like 37, putative [Theobroma cacao] Length = 97 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -3 Query: 374 ELKEALKRNGVWFTSIRSKHYVRSADNNGNGRIEDCEIGNLVEIAKK-LNVKIV 216 EL A++ G WF + +SKH +RS D NGNG I+D EI NL E A+K LNV+I+ Sbjct: 42 ELANAIRAAGGWFATRKSKHAIRSVDANGNGFIDDNEIKNLAEFAEKHLNVRIL 95